SDS-PAGE
Intraflagellar transport protein 27 homolog Recombinant Protein | IFT27 recombinant protein
Recombinant Human Intraflagellar transport protein 27 homolog
Gene Names
IFT27; RAYL; BBS19; RABL4
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Intraflagellar transport protein 27 homolog; Recombinant Human Intraflagellar transport protein 27 homolog; Putative GTP-binding protein RAY-like; Rab-like protein 4; IFT27 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-186aa; Full Length
Sequence
MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDVTNEESFNNCSKWLEKARSQAPGISLPGVLVGNKTDLAGRRAVDSAEARAWALGQGLECFETSVKEMENFEAPFHCLAKQFHQLYREKVEVFRALA
Sequence Length
186
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for IFT27 recombinant protein
Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6. Not involved in entry of the BBSome complex into cilium. Prevents aggregation of GTP-free ARL6. Required for hedgehog signaling. Forms a subcomplex within the IFT complex B with IFT25.
Product Categories/Family for IFT27 recombinant protein
References
Reevaluating human gene annotation
a second-generation analysis of chromosome 22.Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I.Genome Res. 13:27-36(2003)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
36.5 kDa
NCBI Official Full Name
intraflagellar transport protein 27 homolog isoform 1
NCBI Official Synonym Full Names
intraflagellar transport 27
NCBI Official Symbol
IFT27
NCBI Official Synonym Symbols
RAYL; BBS19; RABL4
NCBI Protein Information
intraflagellar transport protein 27 homolog
UniProt Protein Name
Intraflagellar transport protein 27 homolog
Protein Family
UniProt Gene Name
IFT27
UniProt Synonym Gene Names
RABL4; RAYL
UniProt Entry Name
IFT27_HUMAN
NCBI Description
This gene encodes a GTP-binding protein that is a core component of the intraflagellar transport complex B. Characterization of the similar Chlamydomonas protein indicates a function in cell cycle control. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jan 2012]
Uniprot Description
RABL4: Possesses GTPase activity. Belongs to the small GTPase superfamily. Ras family. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: G protein, monomeric; G protein, monomeric, Ras; G protein
Chromosomal Location of Human Ortholog: 22q13.1
Cellular Component: centrosome; cilium
Molecular Function: GTP binding; protein binding
Biological Process: intracellular protein transport; intraflagellar transport; organelle organization and biogenesis; small GTPase mediated signal transduction; smoothened signaling pathway
Research Articles on IFT27
Similar Products
Product Notes
The IFT27 ift27 (Catalog #AAA1487761) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-186aa; Full Length. The amino acid sequence is listed below: MVKLAAKCIL AGDPAVGKTA LAQIFRSDGA HFQKSYTLTT GMDLVVKTVP VPDTGDSVEL FIFDSAGKEL FSEMLDKLWE SPNVLCLVYD VTNEESFNNC SKWLEKARSQ APGISLPGVL VGNKTDLAGR RAVDSAEARA WALGQGLECF ETSVKEMENF EAPFHCLAKQ FHQLYREKVE VFRALA. It is sometimes possible for the material contained within the vial of "Intraflagellar transport protein 27 homolog, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
