Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant Human IFNL3/IL28B/Interleukin-28B Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 23 kDa.)

IFNL3/IL28B/Interleukin-28B Recombinant Protein | IFNL3 recombinant protein

Recombinant Human IFNL3/IL28B/Interleukin-28B Protein

Gene Names
IFNL3; IL28B; IL28C; IL-28B; IL-28C; IFN-lambda-3; IFN-lambda-4
Purity
>95% by SDS-PAGE.
Synonyms
IFNL3/IL28B/Interleukin-28B; Recombinant Human IFNL3/IL28B/Interleukin-28B Protein; IFN-lambda-3; IFN-lambda-4; IL-28B; IL-28C; IL28B; IL28C; IFNL3 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.22 um filtered solution of PBS, 500mM NaCl, pH 7.4.
Sequence
MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
Sequence Length
196
Species
Human
Endotoxin
< 0.1 EU/ug of the protein by LAL method.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant Human IFNL3/IL28B/Interleukin-28B Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 23 kDa.)

SDS-Page (Recombinant Human IFNL3/IL28B/Interleukin-28B Protein was determined by SDS-PAGE with Coomassie Blue, showing a band at 23 kDa.)
Related Product Information for IFNL3 recombinant protein
Description: Recombinant Human IFNL3/IL28B/Interleukin-28B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Val196) of human IFNL3/IL28B/Interleukin-28B (Accession #NP_742151.2) fused with a 6xHis tag at the C-terminus.

Background: Interleukin-28B (IL-28B) also known as Interferon lambda-3 and IFN-lambda-3, belongs to the type III interferon family of cytokines. IL-28B is a cytokine with immunomodulatory activity. It functions in Up-regulating MHC class I antigen expression. IL-28B displays potent antiviral activity and antitumor activity. This cytokine serves as ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. IL-28B is able to increase the percentage of splenic CD8+ T cells in vaccinated animals and have higher antigen-specific cytolytic.
Product Categories/Family for IFNL3 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interferon lambda-3 isoform 2
NCBI Official Synonym Full Names
interferon lambda 3
NCBI Official Symbol
IFNL3
NCBI Official Synonym Symbols
IL28B; IL28C; IL-28B; IL-28C; IFN-lambda-3; IFN-lambda-4
NCBI Protein Information
interferon lambda-3
UniProt Protein Name
Interferon lambda-3
Protein Family
UniProt Gene Name
IFNL3
UniProt Synonym Gene Names
IL28B; IL28C; ZCYTO22; IFN-lambda-3; IL-28B; IL-28C
UniProt Entry Name
IFNL3_HUMAN

NCBI Description

This gene encodes a cytokine distantly related to type I interferons and the IL-10 family. This gene, interleukin 28A (IL28A), and interleukin 29 (IL29) are three closely related cytokine genes that form a cytokine gene cluster on a chromosomal region mapped to 19q13. Expression of the cytokines encoded by the three genes can be induced by viral infection. All three cytokines have been shown to interact with a heterodimeric class II cytokine receptor that consists of interleukin 10 receptor, beta (IL10RB) and interleukin 28 receptor, alpha (IL28RA). [provided by RefSeq, Jul 2008]

Uniprot Description

IL-28B: Cytokine with immunomodulatory activity. Up-regulates MHC class I antigen expression. Displays potent antiviral activity. Also displays antitumor activity. Ligand for the heterodimeric class II cytokine receptor composed of IL10RB and IL28RA. The ligand/receptor complex seems to signal through the Jak-STAT pathway. Belongs to the IL-28/IL-29 family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 19q13.13

Cellular Component: extracellular space

Molecular Function: cytokine activity

Biological Process: positive regulation of immune response; negative regulation of viral genome replication; JAK-STAT cascade; defense response to virus

Disease: Hepatitis C Virus, Susceptibility To

Research Articles on IFNL3

Similar Products

Product Notes

The IFNL3 ifnl3 (Catalog #AAA9141786) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: MTGDCMPVLV LMAAVLTVTG AVPVARLRGA LPDARGCHIA QFKSLSPQEL QAFKRAKDAL EESLLLKDCK CRSRLFPRTW DLRQLQVRER PVALEAELAL TLKVLEATAD TDPALGDVLD QPLHTLHHIL SQLRACIQPQ PTAGPRTRGR LHHWLHRLQE APKKESPGCL EASVTFNLFR LLTRDLNCVA SGDLCV. It is sometimes possible for the material contained within the vial of "IFNL3/IL28B/Interleukin-28B, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.