Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MEF2BSample Tissue: Mouse Spleen lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Mouse MEF2B Polyclonal Antibody | anti-MEF2B antibody

MEF2B Antibody-middle region

Gene Names
Mef2b; AI451606
Reactivity
Mouse
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MEF2B; Polyclonal Antibody; MEF2B Antibody-middle region; Myocyte-specific enhancer factor 2B; AI451606; anti-MEF2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Mouse
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100ul at 0.5-1mg/ml (varies by lot)
Sequence
MDRVLLKYTEYSEPHESRTNADILQTLKRRGVGLDGPELDMEEGPEGPGE
Applicable Applications for anti-MEF2B antibody
Western Blot (WB)
Protein Size
232 amino acids
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of mouse MEF2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MEF2BSample Tissue: Mouse Spleen lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MEF2BSample Tissue: Mouse Spleen lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-MEF2B antibody
Description of Target: Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT]4TAR-3', found in numerous muscle-specific genes. Activates transcription via this element. May be involved in muscle-specific and/or growth factor-related transcription.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,603 Da
NCBI Official Synonym Full Names
myocyte enhancer factor 2B
NCBI Official Symbol
Mef2b
NCBI Official Synonym Symbols
AI451606
NCBI Protein Information
myocyte-specific enhancer factor 2B
UniProt Protein Name
Myocyte-specific enhancer factor 2B
UniProt Gene Name
Mef2b
UniProt Entry Name
MEF2B_MOUSE

Uniprot Description

MEF2B: Transcriptional activator which binds specifically to the MEF2 element, 5'-YTA[AT](4)TAR-3', found in numerous muscle- specific genes. Activates transcription via this element. May be involved in muscle-specific and/or growth factor-related transcription. Belongs to the MEF2 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Cellular Component: nucleoplasm; transcription factor complex; cytoplasm; cell junction; nucleus

Molecular Function: histone deacetylase binding; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter

Research Articles on MEF2B

Similar Products

Product Notes

The MEF2B mef2b (Catalog #AAA3249880) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MEF2B Antibody-middle region reacts with Mouse and may cross-react with other species as described in the data sheet. AAA Biotech's MEF2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MEF2B mef2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MDRVLLKYTE YSEPHESRTN ADILQTLKRR GVGLDGPELD MEEGPEGPGE. It is sometimes possible for the material contained within the vial of "MEF2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.