Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page

Interferon gamma Recombinant Protein | IFNG recombinant protein

Recombinant Human Interferon gamma

Gene Names
IFNG; IFG; IFI
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Interferon gamma; Recombinant Human Interferon gamma; Immune interferon; IFNG recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
24-162
Sequence
QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGR
Sequence Length
166
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-Page

SDS-Page
Related Product Information for IFNG recombinant protein
Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Product Categories/Family for IFNG recombinant protein
References
Structure of the human immune interferon gene.Gray P.W., Goeddel D.V.Nature 298:859-863(1982) Expression of human immune interferon cDNA in E. coli and monkey cells.Gray P.W., Leung D.W., Pennica D., Yelverton E., Najarian R., Simonsen C.C., Derynck R., Sherwood P.J., Wallace D.M., Berger S.L., Levinson A.D., Goeddel D.V.Nature 295:503-508(1982) Cloning and expression of a novel variant of human interferon-gamma cDNA.Nishi T., Fujita T., Nishi-Takaoka C., Saito A., Matsumoto T., Sato M., Oka T., Itoh S., Yip Y.K., Vilcek J., Taniguchi T.J. Biochem. 97:153-159(1985) Cloning and structure of the human immune interferon-gamma chromosomal gene.Taya Y., Devos R., Tavernier J., Cheroutre H., Engler G., Fiers W.EMBO J. 1:953-958(1982) Molecular cloning of human immune interferon cDNA and its expression in eukaryotic cells.Devos R., Cheroutre H., Taya Y., Degrave W., van Heuverswyn H., Fiers W.Nucleic Acids Res. 10:2487-2501(1982) Chikara S.K., Jaiswal P., Sharma G.SeattleSNPs variation discovery resourceHuman protein factory for converting the transcriptome into an in vitro-expressed proteome.Goshima N., Kawamura Y., Fukumoto A., Miura A., Honma R., Satoh R., Wakamatsu A., Yamamoto J., Kimura K., Nishikawa T., Andoh T., Iida Y., Ishikawa K., Ito E., Kagawa N., Kaminaga C., Kanehori K., Kawakami B., Kenmochi K., Kimura R., Kobayashi M., Kuroita T., Kuwayama H., Maruyama Y., Matsuo K., Minami K., Mitsubori M., Mori M., Morishita R., Murase A., Nishikawa A., Nishikawa S., Okamoto T., Sakagami N., Sakamoto Y., Sasaki Y., Seki T., Sono S., Sugiyama A., Sumiya T., Takayama T., Takayama Y., Takeda H., Togashi T., Yahata K., Yamada H., Yanagisawa Y., Endo Y., Imamoto F., Kisu Y., Tanaka S., Isogai T., Imai J., Watanabe S., Nomura N.Nat. Methods 5:1011-1017(2008)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43.7kD
NCBI Official Full Name
interferon gamma
NCBI Official Synonym Full Names
interferon, gamma
NCBI Official Symbol
IFNG
NCBI Official Synonym Symbols
IFG; IFI
UniProt Protein Name
Interferon gamma
Protein Family
UniProt Gene Name
IFNG
UniProt Synonym Gene Names
IFN-gamma
UniProt Entry Name
IFNG_HUMAN

NCBI Description

This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. [provided by RefSeq, Dec 2015]

Uniprot Description

IFNG: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons. Homodimer. Released primarily from activated T lymphocytes. Belongs to the type II (or gamma) interferon family.

Protein type: Secreted, signal peptide; Secreted; Cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 12q14

Cellular Component: external side of plasma membrane; extracellular region; extracellular space; intracellular

Molecular Function: cytokine activity; interferon-gamma receptor binding

Biological Process: adaptive immune response; antigen processing and presentation; apoptosis; CD8-positive, alpha-beta T cell differentiation during immune response; cell cycle arrest; cell motility; cell surface receptor linked signal transduction; cytokine and chemokine mediated signaling pathway; defense response to bacterium; defense response to protozoan; defense response to virus; humoral immune response; negative regulation of epithelial cell differentiation; negative regulation of interleukin-17 production; negative regulation of myelination; negative regulation of smooth muscle cell proliferation; negative regulation of transcription from RNA polymerase II promoter; neutrophil apoptosis; neutrophil chemotaxis; positive regulation of autophagy; positive regulation of CD4-positive, CD25-positive, alpha-beta regulatory T cell differentiation during immune response; positive regulation of cell proliferation; positive regulation of chemokine biosynthetic process; positive regulation of interleukin-1 beta secretion; positive regulation of interleukin-12 biosynthetic process; positive regulation of interleukin-12 production; positive regulation of interleukin-23 production; positive regulation of interleukin-6 biosynthetic process; positive regulation of isotype switching to IgG isotypes; positive regulation of killing of cells of another organism; positive regulation of membrane protein ectodomain proteolysis; positive regulation of MHC class II biosynthetic process; positive regulation of neuron differentiation; positive regulation of nitric oxide biosynthetic process; positive regulation of osteoclast differentiation; positive regulation of peptidyl-serine phosphorylation of STAT protein; positive regulation of synaptic transmission, cholinergic; positive regulation of T cell proliferation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of tumor necrosis factor production; positive regulation of tyrosine phosphorylation of Stat1 protein; protein import into nucleus, translocation; regulation of insulin secretion; regulation of the force of heart contraction; response to drug; response to virus; sensory perception of mechanical stimulus; unfolded protein response

Disease: Aplastic Anemia; Hepatitis C Virus, Susceptibility To; Human Immunodeficiency Virus Type 1, Susceptibility To; Mycobacterium Tuberculosis, Susceptibility To; Tuberous Sclerosis 2

Research Articles on IFNG

Similar Products

Product Notes

The IFNG ifng (Catalog #AAA717084) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 24-162. The amino acid sequence is listed below: QDPYVKEAEN LKKYFNAGHS DVADNGTLFL GILKNWKEES DRKIMQSQIV SFYFKLFKNF KDDQSIQKSV ETIKEDMNVK FFNSNKKKRD DFEKLTNYSV TDLNVQRKAI HELIQVMAEL SPAAKTGKRK RSQMLFRGR. It is sometimes possible for the material contained within the vial of "Interferon gamma, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.