SDS-PAGE
Intercellular adhesion molecule 4 Recombinant Protein | Icam4 recombinant protein
Recombinant Mouse Intercellular adhesion molecule 4
Gene Names
Icam4; Cd242; ICAM-4; 1810015M19Rik
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Intercellular adhesion molecule 4; Recombinant Mouse Intercellular adhesion molecule 4; CD_antigen: CD242; Icam4 recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
23-231aa; Extracellular Domain
Sequence
QQEWMQSPPAPSVTSAPFWVRLNPELEAVPPGGSAWLNCSHNCPLPVHSSLRTQLRQGKIVNGSGWVSYQLLDVRAWNSKVRCVVTCAGETREATARITAYKRPRSVILEPPVLVGHKYTLRCYVTHVFPVGFLVVSLRRGGRVIYHESLERFTGSDLANVTLTYVMRAGLNDLWQPLTCHARLNLDGLVVRSSSAPVMLTVLALSPAS
Sequence Length
262
Species
Mus musculus (Mouse)
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.
SDS-PAGE
SDS-PAGE
Related Product Information for Icam4 recombinant protein
Adhesion molecule that binds to leukocyte adhesion LFA-1 protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins (By similarity). Isoform 2 may modulate binding of membrane-associated ICAM4.
References
"Novel secreted isoform of adhesion molecule ICAM-4: potential regulator of membrane-associated ICAM-4 interactions."
Lee G., Spring F.A., Parsons S.F., Mankelow T.J., Peters L.L., Koury M.J., Mohandas N., Anstee D.J., Chasis J.A.
Blood 101:1790-1797(2003)
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
39.1 kDa
NCBI Official Full Name
intercellular adhesion molecule 4
NCBI Official Synonym Full Names
intercellular adhesion molecule 4, Landsteiner-Wiener blood group
NCBI Official Symbol
Icam4
NCBI Official Synonym Symbols
Cd242; ICAM-4; 1810015M19Rik
NCBI Protein Information
intercellular adhesion molecule 4
UniProt Protein Name
Intercellular adhesion molecule 4
Protein Family
UniProt Gene Name
Icam4
UniProt Synonym Gene Names
ICAM-4
UniProt Entry Name
ICAM4_MOUSE
Uniprot Description
ICAM4: ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins. Belongs to the immunoglobulin superfamily. ICAM family. 3 isoforms of the human protein are produced by alternative splicing.
Protein type: Membrane protein, integral
Cellular Component: cytoplasm; extracellular region; extracellular space; integral to membrane; integral to plasma membrane; membrane; plasma membrane
Molecular Function: integrin binding
Biological Process: cell adhesion; cell-cell adhesion
Research Articles on Icam4
Similar Products
Product Notes
The Icam4 icam4 (Catalog #AAA1420833) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 23-231aa; Extracellular Domain. The amino acid sequence is listed below: QQEWMQSPPA PSVTSAPFWV RLNPELEAVP PGGSAWLNCS HNCPLPVHSS LRTQLRQGKI VNGSGWVSYQ LLDVRAWNSK VRCVVTCAGE TREATARITA YKRPRSVILE PPVLVGHKYT LRCYVTHVFP VGFLVVSLRR GGRVIYHESL ERFTGSDLAN VTLTYVMRAG LNDLWQPLTC HARLNLDGLV VRSSSAPVML TVLALSPAS. It is sometimes possible for the material contained within the vial of "Intercellular adhesion molecule 4, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
