Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of ICAM4 expression in transfected 293T cell line by ICAM4 polyclonal antibody. Lane 1: ICAM4 transfected lysate (29.92kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human ICAM4 Polyclonal Antibody | anti-ICAM4 antibody

ICAM4 (Intercellular Adhesion Molecule 4, ICAM-4, Landsteiner-Wiener Blood Group Glycoprotein, LW Blood Group Protein, CD242, LW)

Gene Names
ICAM4; LW; CD242
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
ICAM4; Polyclonal Antibody; ICAM4 (Intercellular Adhesion Molecule 4; ICAM-4; Landsteiner-Wiener Blood Group Glycoprotein; LW Blood Group Protein; CD242; LW); Anti -ICAM4 (Intercellular Adhesion Molecule 4; anti-ICAM4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human ICAM4.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MGSLFPLSLLFFLAAAYPGVGSALGRRTKRAQSPKGSPLAPSGTSVPFWVRMSPEFVAVQPGKSVQLNCSNSCPQPQNSSLRTPLRQGKTLRGPGWVSYQLLDVRAWSSLAHCLVTCAGKTRWATSRITAYSVPGGLLGGDPEAWKPGHLFRKPGALHRPGSGQRDLDLRVCCWTPRLLAARDLPRAPQSRRPGGPQQLGTHYTDARLEPRAHSFGLRFHRCPCRDPPHCGRCVPMQVPSYEVPGVKGDVLCRLSEKKRNMKQSGEMAIHGG
Applicable Applications for anti-ICAM4 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human ICAM4, aa1-272 (NP_001034221.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of ICAM4 expression in transfected 293T cell line by ICAM4 polyclonal antibody. Lane 1: ICAM4 transfected lysate (29.92kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of ICAM4 expression in transfected 293T cell line by ICAM4 polyclonal antibody. Lane 1: ICAM4 transfected lysate (29.92kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-ICAM4 antibody
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins.
Product Categories/Family for anti-ICAM4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,265 Da
NCBI Official Full Name
intercellular adhesion molecule 4 isoform 3
NCBI Official Synonym Full Names
intercellular adhesion molecule 4 (Landsteiner-Wiener blood group)
NCBI Official Symbol
ICAM4
NCBI Official Synonym Symbols
LW; CD242
NCBI Protein Information
intercellular adhesion molecule 4; CD242 antigen; LW blood group protein; Landsteiner-Wiener blood group antigen a; Landsteiner-Wiener blood group glycoprotein; intercellular adhesion molecule 4 (LW blood group)
UniProt Protein Name
Intercellular adhesion molecule 4
UniProt Gene Name
ICAM4
UniProt Synonym Gene Names
LW; ICAM-4
UniProt Entry Name
ICAM4_HUMAN

NCBI Description

This gene encodes the Landsteiner-Wiener (LW) blood group antigen(s) that belongs to the immunoglobulin (Ig) superfamily, and that shares similarity with the intercellular adhesion molecule (ICAM) protein family. This ICAM protein contains 2 Ig-like C2-type domains and binds to the leukocyte adhesion LFA-1 protein. The molecular basis of the LW(A)/LW(B) blood group antigens is a single aa variation at position 100; Gln-100=LW(A) and Arg-100=LW(B). Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Jul 2008]

Uniprot Description

ICAM4: ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). ICAM4 is also a ligand for alpha-4/beta-1 and alpha-V integrins. Belongs to the immunoglobulin superfamily. ICAM family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.2-cen

Disease: Blood Group System, Landsteiner-wiener

Research Articles on ICAM4

Similar Products

Product Notes

The ICAM4 icam4 (Catalog #AAA644356) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The ICAM4 (Intercellular Adhesion Molecule 4, ICAM-4, Landsteiner-Wiener Blood Group Glycoprotein, LW Blood Group Protein, CD242, LW) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's ICAM4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the ICAM4 icam4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MGSLFPLSLL FFLAAAYPGV GSALGRRTKR AQSPKGSPLA PSGTSVPFWV RMSPEFVAVQ PGKSVQLNCS NSCPQPQNSS LRTPLRQGKT LRGPGWVSYQ LLDVRAWSSL AHCLVTCAGK TRWATSRITA YSVPGGLLGG DPEAWKPGHL FRKPGALHRP GSGQRDLDLR VCCWTPRLLA ARDLPRAPQS RRPGGPQQLG THYTDARLEP RAHSFGLRFH RCPCRDPPHC GRCVPMQVPS YEVPGVKGDV LCRLSEKKRN MKQSGEMAIH GG. It is sometimes possible for the material contained within the vial of "ICAM4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.