Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Intercellular Adhesion Molecule-1 Recombinant Protein | ICAM1 recombinant protein

Recombinant Human Intercellular Adhesion Molecule-1, HEK

Gene Names
ICAM1; BB2; CD54; P3.58
Purity
Greater than 95% as determined by SDS-PAGE.
Synonyms
Intercellular Adhesion Molecule-1; Recombinant Human Intercellular Adhesion Molecule-1; HEK; ICAM1 Human HEK; Intercellular Adhesion Molecule-1 Human Recombinant HEK; Intercellular adhesion molecule 1; ICAM-1; Major group rhinovirus receptor; CD54 antigen; ICAM1; BB2; CD54; P3.58; ICAM1 HEK; ICAM1 recombinant protein
Ordering
For Research Use Only!
Host
HEK293 Cells
Purity/Purification
Greater than 95% as determined by SDS-PAGE.
Form/Format
ICAM1 was lyophilized from a 0.2 uM filtered solution of 20mM PB and 150mM NaCl, pH 7.2.
Sterile Filtered White lyophilized (freeze-dried) powder.
Sequence
TTPQTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYEVDHHHHHH.
Sequence Length
532
Solubility
It is recommended to reconstitute the lyophilized ICAM1 in 1xPBS to a concentration no less than 100 ug/ml, which can then be further diluted to other aqueous solutions.
Related Product Information for ICAM1 recombinant protein
Description: ICAM1 Human Recombinant produced by mammalian expression system in human cells is a single polypeptide chain containing 461 amino acids (28-480). ICAM1 is fused to an 8 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

Introduction: ICAM-1 also called CD54 is a single chain membrane glycoprotein expressed on the surface of a variety of non-haematopoietic and haematopoietic cell types and has roles in signal transduction, cell signaling and lymphocyte adhesion. ICAM1 binds to integrins such as CD11a / CD18, or CD11b / CD18. ICAM1 is also used by Rhinovirus as a receptor. ICAM-1 is an intercellular adhesion molecule constantly present in low concentrations in the membranes of leukocytes and endothelial cells. When stimulated by cytokine the concentrations significantly increase. ICAM-1 can be stimulated by interleukin-1 (IL-1) and tumor necrosis factor alpha (TNFA) and is expressed by the vascular endothelium, macrophages and lymphocytes. ICAM-1 is a ligand for LFA-1 which is a receptor found on leukocytes. Upon activation, leukocytes bind to endothelial cells via ICAM-1/LFA-1 and then transmigrate into tissues.ICAM-1 is implicated in subarachnoid hemorrhage (SAH). Levels of ICAM-1 are shown to be notably elevated in patients with SAH. Soluble ICAM-1 is detectable in the plasma and is elevated in patients with various inflammatory conditions.
Product Categories/Family for ICAM1 recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57,825 Da
NCBI Official Full Name
intercellular adhesion molecule 1
NCBI Official Synonym Full Names
intercellular adhesion molecule 1
NCBI Official Symbol
ICAM1
NCBI Official Synonym Symbols
BB2; CD54; P3.58
NCBI Protein Information
intercellular adhesion molecule 1; ICAM-1; cell surface glycoprotein P3.58; intercellular adhesion molecule 1 (CD54), human rhinovirus receptor; major group rhinovirus receptor
UniProt Protein Name
Intercellular adhesion molecule 1
UniProt Gene Name
ICAM1
UniProt Synonym Gene Names
ICAM-1
UniProt Entry Name
ICAM1_HUMAN

NCBI Description

This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by RefSeq, Jul 2008]

Uniprot Description

ICAM1: a type I membrane protein of the immunoglobulin superfamily. Is a ligand for the leukocyte adhesion LFA-1 protein (Integrin alpha-L/beta-2) and a Rhinovirus receptor. Typically expressed on endothelial cells and cells of the immune system. ICAM1 binds to integrins of type CD11a / CD18, or CD11b / CD18. Its expression is activated by p53 in an NF-kappaB-independent manner. Induced by TNFalpha in a process that involves IKKbeta.

Protein type: Cell adhesion; Membrane protein, integral; Immunoglobulin superfamily

Chromosomal Location of Human Ortholog: 19p13.3-p13.2

Cellular Component: extracellular space; focal adhesion; cell surface; membrane; integral to plasma membrane; plasma membrane; immunological synapse; external side of plasma membrane

Molecular Function: integrin binding; viral receptor activity; protein binding; transmembrane receptor activity; receptor activity

Biological Process: entry of virus into host cell; extracellular matrix organization and biogenesis; positive regulation of nitric oxide biosynthetic process; T cell antigen processing and presentation; response to organic cyclic substance; activation of NF-kappaB transcription factor; positive regulation of cellular extravasation; regulation of cell shape; cellular response to nutrient levels; leukocyte adhesion; sensory perception of sound; ovarian follicle development; T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell; membrane to membrane docking; response to sulfur dioxide; cell adhesion; regulation of leukocyte mediated cytotoxicity; acute inflammatory response to antigenic stimulus; response to drug; regulation of cell adhesion; virion attachment, binding of host cell surface receptor; negative regulation of calcium ion transport; regulation of immune response; cytokine and chemokine mediated signaling pathway; response to amphetamine; cell aging; response to amino acid stimulus; heterophilic cell adhesion; positive regulation of peptidyl-tyrosine phosphorylation; response to ethanol; positive regulation of actin filament polymerization; response to copper ion; positive regulation of vasoconstriction; adhesion to host; cell adhesion mediated by integrin; response to ionizing radiation; leukocyte migration

Disease: Malaria, Susceptibility To

Research Articles on ICAM1

Similar Products

Product Notes

The ICAM1 icam1 (Catalog #AAA145998) is a Recombinant Protein produced from HEK293 Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: TTPQTSVSPS KVILPRGGSV LVTCSTSCDQ PKLLGIETPL PKKELLLPGN NRKVYELSNV QEDSQPMCYS NCPDGQSTAK TFLTVYWTPE RVELAPLPSW QPVGKNLTLR CQVEGGAPRA NLTVVLLRGE KELKREPAVG EPAEVTTTVL VRRDHHGANF SCRTELDLRP QGLELFENTS APYQLQTFVL PATPPQLVSP RVLEVDTQGT VVCSLDGLFP VSEAQVHLAL GDQRLNPTVT YGNDSFSAKA SVSVTAEDEG TQRLTCAVIL GNQSQETLQT VTIYSFPAPN VILTKPEVSE GTEVTVKCEA HPRAKVTLNG VPAQPLGPRA QLLLKATPED NGRSFSCSAT LEVAGQLIHK NQTRELRVLY GPRLDERDCP GNWTWPENSQ QTPMCQAWGN PLPELKCLKD GTFPLPIGES VTVTRDLEGT YLCRARSTQG EVTRKVTVNV LSPRYEVDHH HHHH.. It is sometimes possible for the material contained within the vial of "Intercellular Adhesion Molecule-1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.