Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Intercellular adhesion molecule 1 Recombinant Protein | ICAM1 recombinant protein

Recombinant Human Intercellular adhesion molecule 1

Gene Names
ICAM1; BB2; CD54; P3.58
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Intercellular adhesion molecule 1; Recombinant Human Intercellular adhesion molecule 1; Major group rhinovirus receptor; CD54; ICAM1 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
28-480aa; Partial
Sequence
QTSVSPSKVILPRGGSVLVTCSTSCDQPKLLGIETPLPKKELLLPGNNRKVYELSNVQEDSQPMCYSNCPDGQSTAKTFLTVYWTPERVELAPLPSWQPVGKNLTLRCQVEGGAPRANLTVVLLRGEKELKREPAVGEPAEVTTTVLVRRDHHGANFSCRTELDLRPQGLELFENTSAPYQLQTFVLPATPPQLVSPRVLEVDTQGTVVCSLDGLFPVSEAQVHLALGDQRLNPTVTYGNDSFSAKASVSVTAEDEGTQRLTCAVILGNQSQETLQTVTIYSFPAPNVILTKPEVSEGTEVTVKCEAHPRAKVTLNGVPAQPLGPRAQLLLKATPEDNGRSFSCSATLEVAGQLIHKNQTRELRVLYGPRLDERDCPGNWTWPENSQQTPMCQAWGNPLPELKCLKDGTFPLPIGESVTVTRDLEGTYLCRARSTQGEVTRKVTVNVLSPRYE
Sequence Length
532
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for ICAM1 recombinant protein
ICAM proteins are ligands for the leukocyte adhesion protein LFA-1 (integrin alpha-L/beta-2). During leukocyte trans-endothelial migration, ICAM1 engagent promotes the assembly of endothelial apical cups through ARHGEF26/SGEF and RHOG activation. In case of rhinovirus infection acts as a cellular receptor for the virus.
Product Categories/Family for ICAM1 recombinant protein
References
ICAM, an adhesion ligand of LFA-1, is homologous to the neural cell adhesion molecule NCAM.Simmons D., Makgoba M.W., Seed B.Nature 331:624-627(1988)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
76.5 kDa
NCBI Official Full Name
intercellular adhesion molecule 1
NCBI Official Synonym Full Names
intercellular adhesion molecule 1
NCBI Official Symbol
ICAM1
NCBI Official Synonym Symbols
BB2; CD54; P3.58
NCBI Protein Information
intercellular adhesion molecule 1
UniProt Protein Name
Intercellular adhesion molecule 1
UniProt Gene Name
ICAM1
UniProt Synonym Gene Names
ICAM-1
UniProt Entry Name
ICAM1_HUMAN

NCBI Description

This gene encodes a cell surface glycoprotein which is typically expressed on endothelial cells and cells of the immune system. It binds to integrins of type CD11a / CD18, or CD11b / CD18 and is also exploited by Rhinovirus as a receptor. [provided by RefSeq, Jul 2008]

Uniprot Description

ICAM1: a type I membrane protein of the immunoglobulin superfamily. Is a ligand for the leukocyte adhesion LFA-1 protein (Integrin alpha-L/beta-2) and a Rhinovirus receptor. Typically expressed on endothelial cells and cells of the immune system. ICAM1 binds to integrins of type CD11a / CD18, or CD11b / CD18. Its expression is activated by p53 in an NF-kappaB-independent manner. Induced by TNFalpha in a process that involves IKKbeta.

Protein type: Cell adhesion; Immunoglobulin superfamily; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.3-p13.2

Cellular Component: cell surface; external side of plasma membrane; extracellular space; focal adhesion; immunological synapse; integral to plasma membrane; lipid raft; membrane; plasma membrane

Molecular Function: integrin binding; protein binding; receptor activity; transmembrane receptor activity; viral receptor activity

Biological Process: activation of NF-kappaB transcription factor; acute inflammatory response to antigenic stimulus; adhesion to host; cell adhesion; cell adhesion mediated by integrin; cell aging; cellular response to nutrient levels; cytokine and chemokine mediated signaling pathway; entry of virus into host cell; extracellular matrix organization and biogenesis; heterophilic cell adhesion; leukocyte adhesion; leukocyte migration; membrane to membrane docking; negative regulation of calcium ion transport; ovarian follicle development; positive regulation of actin filament polymerization; positive regulation of cellular extravasation; positive regulation of GTPase activity; positive regulation of nitric oxide biosynthetic process; positive regulation of peptidyl-tyrosine phosphorylation; positive regulation of vasoconstriction; regulation of cell adhesion; regulation of cell shape; regulation of immune response; regulation of leukocyte mediated cytotoxicity; response to amino acid stimulus; response to amphetamine; response to copper ion; response to drug; response to ethanol; response to ionizing radiation; response to organic cyclic substance; response to sulfur dioxide; sensory perception of sound; T cell activation via T cell receptor contact with antigen bound to MHC molecule on antigen presenting cell; T cell antigen processing and presentation; virion attachment, binding of host cell surface receptor

Disease: Malaria, Susceptibility To

Research Articles on ICAM1

Similar Products

Product Notes

The ICAM1 icam1 (Catalog #AAA717392) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 28-480aa; Partial. The amino acid sequence is listed below: QTSVSPSKVI LPRGGSVLVT CSTSCDQPKL LGIETPLPKK ELLLPGNNRK VYELSNVQED SQPMCYSNCP DGQSTAKTFL TVYWTPERVE LAPLPSWQPV GKNLTLRCQV EGGAPRANLT VVLLRGEKEL KREPAVGEPA EVTTTVLVRR DHHGANFSCR TELDLRPQGL ELFENTSAPY QLQTFVLPAT PPQLVSPRVL EVDTQGTVVC SLDGLFPVSE AQVHLALGDQ RLNPTVTYGN DSFSAKASVS VTAEDEGTQR LTCAVILGNQ SQETLQTVTI YSFPAPNVIL TKPEVSEGTE VTVKCEAHPR AKVTLNGVPA QPLGPRAQLL LKATPEDNGR SFSCSATLEV AGQLIHKNQT RELRVLYGPR LDERDCPGNW TWPENSQQTP MCQAWGNPLP ELKCLKDGTF PLPIGESVTV TRDLEGTYLC RARSTQGEVT RKVTVNVLSP RYE. It is sometimes possible for the material contained within the vial of "Intercellular adhesion molecule 1, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.