Chmp2b blocking peptide
Chmp2b Peptide - N-terminal region
Gene Names
Chmp2b; RGD1306781
Reactivity
Rat, Human
Applications
Western Blot
Synonyms
Chmp2b; Chmp2b Peptide - N-terminal region; Chmp2b blocking peptide
Reactivity
Rat, Human
Form/Format
Lyophilized powder
Sequence
ASLFKKKTVDDVIKEQNRELRGTQRAIIRDRAALEKQEKQLELEIKKMAK
Sequence Length
213
Applicable Applications for Chmp2b blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Chmp2b blocking peptide
This is a synthetic peptide designed for use in combination with anti-Chmp2b Antibody, made
Target Description: Chmp2b is involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Chmp2b recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Chmp2b redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery Chmp2b also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Involved in cytokinesis .
Target Description: Chmp2b is involved in late steps of the endosomal multivesicular bodies (MVB) pathway. Chmp2b recognizes membrane-associated ESCRT-III assemblies and catalyzes their disassembly, possibly in combination with membrane fission. Chmp2b redistributes the ESCRT-III components to the cytoplasm for further rounds of MVB sorting. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. In conjunction with the ESCRT machinery Chmp2b also appears to function in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis. Involved in cytokinesis .
Product Categories/Family for Chmp2b blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
23kDa
NCBI Official Full Name
charged multivesicular body protein 2b
NCBI Official Synonym Full Names
charged multivesicular body protein 2B
NCBI Official Symbol
Chmp2b
NCBI Official Synonym Symbols
RGD1306781
NCBI Protein Information
charged multivesicular body protein 2b
Protein Family
Similar Products
Product Notes
The Chmp2b (Catalog #AAA3236919) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Chmp2b Peptide - N-terminal region reacts with Rat, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Chmp2b can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Chmp2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ASLFKKKTVD DVIKEQNREL RGTQRAIIRD RAALEKQEKQ LELEIKKMAK. It is sometimes possible for the material contained within the vial of "Chmp2b, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
