Charged multivesicular body protein 2a Recombinant Protein | CHMP2A recombinant protein

Recombinant Human Charged multivesicular body protein 2a

Cat. Num. AAA717102

• Gene Names: CHMP2A; BC2; BC-2; VPS2; CHMP2; VPS2A
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Charged multivesicular body protein 2a; Recombinant Human Charged multivesicular body protein 2a; Chromatin-modifying protein 2a; CHMP2a; Putative breast adenocarcinoma marker BC-2; Vacuolar protein sorting-associated protein 2-1; Vps2-1; hVps2-1; CHMP2A recombinant protein

• Host: E Coli
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Liquid containing glycerol
• Sequence Positions: 1-222aa; Full Length
• Sequence: MDLLFGRRKTPEELLRQNQRALNRAMRELDRERQKLETQEKKIIADIKKMAKQGQMDAVRIMAKDLVRTRRYVRKFVLMRANIQAVSLKIQTLKSNNSMAQAMKGVTKAMGTMNRQLKLPQIQKIMMEFERQAEIMDMKEEMMNDAIDDAMGDEEDEEESDAVVSQVLDELGLSLTDELSNLPSTGGSLSVAAGGKKAEAAASALADADADLEERLKNLRRD
• Sequence Length: 222

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for CHMP2A recombinant protein

Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in HIV-1 p6- and p9-dependent virus release.

Product Categories/Family for CHMP2A recombinant protein

Transport

References

Slater C., Thill G., Obar R.Role of the BC-2 gene in breast cancer.Koczan D., Reimer T., Rump A., Merck-Rousseau M.F., Rosenthal A., Friese K., Thiesen H.J.NovelFam3000 -- uncharacterized human protein domains conserved across model organisms.Kemmer D., Podowski R.M., Arenillas D., Lim J., Hodges E., Roth P., Sonnhammer E.L.L., Hoeoeg C., Wasserman W.W.BMC Genomics 7:48-48(2006)

NCBI and Uniprot Product Information

• NCBI GI #: 7656922
• NCBI GeneID: 27243
• NCBI Accession #: NP_055268.1
• NCBI GenBank Nucleotide #: NM_014453.3
• UniProt Accession #: O43633; Q3ZTT0; B2R4W6
• Molecular Weight: 52.1 kDa
• NCBI Official Full Name: charged multivesicular body protein 2a
• NCBI Official Synonym Full Names: charged multivesicular body protein 2A
• NCBI Official Symbol: CHMP2A
• NCBI Official Synonym Symbols: BC2; BC-2; VPS2; CHMP2; VPS2A
• NCBI Protein Information: charged multivesicular body protein 2a
• UniProt Protein Name: Charged multivesicular body protein 2a
• Protein Family: Charged multivesicular body protein
• UniProt Gene Name: CHMP2A
• UniProt Synonym Gene Names: BC2; CHMP2; CHMP2a; Vps2-1; hVps2-1
• UniProt Entry Name: CHM2A_HUMAN

NCBI Description

CHMP2A belongs to the chromatin-modifying protein/charged multivesicular body protein (CHMP) family. These proteins are components of ESCRT-III (endosomal sorting complex required for transport III), a complex involved in degradation of surface receptor proteins and formation of endocytic multivesicular bodies (MVBs). Some CHMPs have both nuclear and cytoplasmic/vesicular distributions, and one such CHMP, CHMP1A (MIM 164010), is required for both MVB formation and regulation of cell cycle progression (Tsang et al., 2006 [PubMed 16730941]).[supplied by OMIM, Mar 2008]

Uniprot Description

CHMP2A: Probable core component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intraluminal vesicles (ILVs) that are generated by invagination and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes enabling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invaginating membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the terminal stages of cytokinesis and the budding of enveloped viruses (HIV-1 and other lentiviruses). ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4. Involved in HIV- 1 p6- and p9-dependent virus release. Belongs to the SNF7 family.

Chromosomal Location of Human Ortholog: 19q

Cellular Component: cytosol; late endosome membrane; membrane; membrane coat

Molecular Function: phosphatidylcholine binding; protein binding; protein domain specific binding

Biological Process: autophagy; cell separation during cytokinesis; endosome transport; establishment of protein localization; membrane invagination; mitotic metaphase plate congression; nuclear organization and biogenesis; post-Golgi vesicle-mediated transport; protein heterooligomerization; protein homooligomerization; protein polymerization; protein transport; regulation of viral reproduction; vacuolar transport; viral infectious cycle; viral reproduction