Wnt8b blocking peptide
Wnt8b Peptide - C-terminal region
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Wnt8b; Wnt8b Peptide - C-terminal region; Wnt8b blocking peptide
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
SISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRR
Sequence Length
350
Applicable Applications for Wnt8b blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Wnt8b blocking peptide
This is a synthetic peptide designed for use in combination with anti-Wnt8b Antibody, made
Target Description: Wnt8b is a ligand for members of the frizzled family of seven transmembrane receptors. It may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.
Target Description: Wnt8b is a ligand for members of the frizzled family of seven transmembrane receptors. It may play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.
Product Categories/Family for Wnt8b blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
38kDa
NCBI Official Full Name
protein Wnt-8b
NCBI Official Synonym Full Names
wingless-type MMTV integration site family, member 8B
NCBI Official Symbol
Wnt8b
NCBI Protein Information
protein Wnt-8b
UniProt Protein Name
Protein Wnt-8b
Protein Family
UniProt Gene Name
Wnt8b
Uniprot Description
WNT8B: Ligand for members of the frizzled family of seven transmembrane receptors. May play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus. Belongs to the Wnt family.
Protein type: Secreted; Secreted, signal peptide
Chromosomal Location of Human Ortholog: 19 C3|19 37.98 cM
Cellular Component: extracellular space
Molecular Function: frizzled binding; receptor binding
Biological Process: cell fate commitment; cell-cell signaling; neuron differentiation; organ morphogenesis; signal transduction; Wnt receptor signaling pathway
Research Articles on Wnt8b
Similar Products
Product Notes
The Wnt8b wnt8b (Catalog #AAA3238678) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Wnt8b Peptide - C-terminal region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Wnt8b can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Wnt8b wnt8b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SISTRELVHL EDSPDYCLEN KTLGLLGTEG RECLRRGRAL GRWERRSCRR. It is sometimes possible for the material contained within the vial of "Wnt8b, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
