SDS-Page
Protein Wnt-8b (Wnt8b) Recombinant Protein | Wnt8b recombinant protein
Recombinant Mouse Protein Wnt-8b (Wnt8b)
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Protein Wnt-8b (Wnt8b); Recombinant Mouse Protein Wnt-8b (Wnt8b); Protein Wnt-8b; Wnt8b recombinant protein
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
22-350. Full Length of Mature Protein
Sequence
WSVNNFLMTGPKAYLVYSSSVAAGAQSGIEECKYQFAWDRWNCPERALQLSSHGGLRSANRETAFVHAISSAGVMYTLTRNCSLGDFDNCGCDDSRNGQLGGQGWLWGGCSDNVGFGEAISKQFVDALETGQDARAAMNLHNNEAGRKAVKGTMKRTCKCHGVSGSCTTQTCWLQLPEFREVGAHLKEKYHAALKVDLLQGAGNSAAGRGAIADTFRSISTRELVHLEDSPDYCLENKTLGLLGTEGRECLRRGRALGRWERRSCRRLCGDCGLAVEERRAETVSSCNCKFHWCCAVRCEQCRRRVTKYFCSRAERPPRGAAHKPGKNS
Species
Mus musculus (Mouse)
Production Note
Special Offer: The E Coli host-expressed protein is manufactured from a stock plasmid containing the protein gene. E Colihost-expressed protein is stocked in different unit sizes ranging from as small as 10 ug to as large as 1 mg. Bulk inventory is also available. The E Coli host-expressed protein has been ordered over and over again by researchers and has stood the test of time as both a robust protein and important target for the research community. It is part of our new program to make our most popular protein targets and corresponding hosts available in expanded unit sizes and with a quick processing time. Select E Coli host-expressed protein for the fastest delivery among all hosts. Please contact our technical support team or email to [email protected] for more details.
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.
SDS-Page
SDS-Page
Related Product Information for Wnt8b recombinant protein
Ligand for members of the frizzled family of seven transmembrane receptors. May play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus.
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
56.2 kDa
NCBI Official Full Name
Protein Wnt-8b
NCBI Official Synonym Full Names
wingless-type MMTV integration site family, member 8B
NCBI Official Symbol
Wnt8b
NCBI Protein Information
protein Wnt-8b; wingless related MMTV integration site 8b
UniProt Protein Name
Protein Wnt-8b
Protein Family
UniProt Gene Name
Wnt8b
UniProt Entry Name
WNT8B_MOUSE
Uniprot Description
WNT8B: Ligand for members of the frizzled family of seven transmembrane receptors. May play an important role in the development and differentiation of certain forebrain structures, notably the hippocampus. Belongs to the Wnt family.
Protein type: Secreted; Secreted, signal peptide
Cellular Component: extracellular space; proteinaceous extracellular matrix; extracellular region
Molecular Function: frizzled binding; receptor binding
Biological Process: neuron differentiation; organ morphogenesis; Wnt receptor signaling pathway; cell fate commitment; cell-cell signaling; multicellular organismal development; signal transduction
Research Articles on Wnt8b
Similar Products
Product Notes
The Wnt8b wnt8b (Catalog #AAA1391066) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 22-350. Full Length of Mature Protein. The amino acid sequence is listed below: WSVNNFLMTG PKAYLVYSSS VAAGAQSGIE ECKYQFAWDR WNCPERALQL SSHGGLRSAN RETAFVHAIS SAGVMYTLTR NCSLGDFDNC GCDDSRNGQL GGQGWLWGGC SDNVGFGEAI SKQFVDALET GQDARAAMNL HNNEAGRKAV KGTMKRTCKC HGVSGSCTTQ TCWLQLPEFR EVGAHLKEKY HAALKVDLLQ GAGNSAAGRG AIADTFRSIS TRELVHLEDS PDYCLENKTL GLLGTEGREC LRRGRALGRW ERRSCRRLCG DCGLAVEERR AETVSSCNCK FHWCCAVRCE QCRRRVTKYF CSRAERPPRG AAHKPGKNS . It is sometimes possible for the material contained within the vial of "Protein Wnt-8b (Wnt8b), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
