Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Tceal7 blocking peptide

Tceal7 Peptide - middle region

Gene Names
Tceal7; 1110018P05Rik
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Tceal7; Tceal7 Peptide - middle region; Tceal7 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
RLLQSLEEFKEDIDYRHFKGEEMTGEEEEMERCLEEIRSLRKKFRALHSN
Sequence Length
98
Applicable Applications for Tceal7 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Tceal7 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Tceal7 Antibody, made

Target Description: Tceal7 plays a role in the negative regulation of NF-kappa-B signaling at the basal level by modulating transcriptional activity of NF-kappa-B on its target gene promoters. Tceal7 associates with cyclin D1 promoter containing Myc E-box sequence and transcriptionally represses cyclin D1 expression. Tceal7 regulates telomerase reverse transcriptase expression and telomerase activity in both ALT (alternative lengthening of telomeres)and telomerase-positive cell lines.
Product Categories/Family for Tceal7 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
10kDa
NCBI Official Full Name
transcription elongation factor A protein-like 7
NCBI Official Synonym Full Names
transcription elongation factor A (SII)-like 7
NCBI Official Symbol
Tceal7
NCBI Official Synonym Symbols
1110018P05Rik
NCBI Protein Information
transcription elongation factor A protein-like 7
UniProt Protein Name
Transcription elongation factor A protein-like 7
UniProt Gene Name
Tceal7
UniProt Synonym Gene Names
TCEA-like protein 7
UniProt Entry Name
TCAL7_MOUSE

Research Articles on Tceal7

Similar Products

Product Notes

The Tceal7 tceal7 (Catalog #AAA3235053) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Tceal7 Peptide - middle region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Tceal7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Tceal7 tceal7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RLLQSLEEFK EDIDYRHFKG EEMTGEEEEM ERCLEEIRSL RKKFRALHSN. It is sometimes possible for the material contained within the vial of "Tceal7, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.