Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Fabp5 blocking peptide

Fabp5 Peptide - C-terminal region

Gene Names
Fabp5; Klbp; mal1; Fabpe; E-FABP; PA-FABP
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Fabp5; Fabp5 Peptide - C-terminal region; Fabp5 blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
RKTETVCTFQDGALVQHQQWDGKESTITRKLKDGKMIVECVMNNATCTRV
Sequence Length
135
Applicable Applications for Fabp5 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Fabp5 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Fabp5 Antibody, made

Target Description: The function of this protein is unknown.
Product Categories/Family for Fabp5 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
fatty acid-binding protein 5 isoform 1
NCBI Official Synonym Full Names
fatty acid binding protein 5, epidermal
NCBI Official Symbol
Fabp5
NCBI Official Synonym Symbols
Klbp; mal1; Fabpe; E-FABP; PA-FABP
NCBI Protein Information
fatty acid-binding protein 5; uncharacterized protein LOC16592
UniProt Protein Name
Fatty acid-binding protein, epidermal
UniProt Gene Name
Fabp5
UniProt Synonym Gene Names
Fabpe; Klbp; Mal1; E-FABP; PA-FABP
UniProt Entry Name
FABP5_MOUSE

NCBI Description

The protein encoded by this gene is part of the fatty acid binding protein family (FABP). FABPs are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands and participate in fatty acid uptake, transport, and metabolism. In humans this gene has been associated with psoriasis and type 2 diabetes. In mouse deficiency of this gene in combination with a deficiency in Fabp4 confers protection against atherosclerosis, diet-induced obesity, insulin resistance and experimental autoimmune encephalomyelitis (the mouse model for multiple sclerosis). Alternative splicing results in multiple transcript variants that encode different protein isoforms. The mouse genome contains many pseudogenes similar to this locus. [provided by RefSeq, Jan 2013]

Uniprot Description

FABP5: High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation. Belongs to the calycin superfamily. Fatty-acid binding protein (FABP) family.

Protein type: Lipid-binding

Cellular Component: cytoplasm

Molecular Function: transporter activity; fatty acid binding; lipid binding

Biological Process: transport; phosphatidylcholine biosynthetic process; glucose metabolic process; glucose transport; lipid metabolic process

Research Articles on Fabp5

Similar Products

Product Notes

The Fabp5 fabp5 (Catalog #AAA3239576) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Fabp5 Peptide - C-terminal region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Fabp5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Fabp5 fabp5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: RKTETVCTFQ DGALVQHQQW DGKESTITRK LKDGKMIVEC VMNNATCTRV. It is sometimes possible for the material contained within the vial of "Fabp5, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.