Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Etfdh blocking peptide

Etfdh Peptide - middle region

Gene Names
Etfdh; AV001013; 0610010I20Rik
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Etfdh; Etfdh Peptide - middle region; Etfdh blocking peptide
Ordering
For Research Use Only!
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: EVLYHEDGSVKGIATNDVGIQKDGAPKTTFERGLELHAKVTVFAEGCHGH
Sequence Length
616
Applicable Applications for Etfdh blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Etfdh blocking peptide
This is a synthetic peptide designed for use in combination with anti-Etfdh Antibody, made

Target Description: Etfdh accepts electrons from ETF and reduces ubiquinone.
Product Categories/Family for Etfdh blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
NCBI Official Synonym Full Names
electron transferring flavoprotein, dehydrogenase
NCBI Official Symbol
Etfdh
NCBI Official Synonym Symbols
AV001013; 0610010I20Rik
NCBI Protein Information
electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
UniProt Protein Name
Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
UniProt Gene Name
Etfdh
UniProt Synonym Gene Names
ETF-QO; ETF-ubiquinone oxidoreductase; ETF dehydrogenase
UniProt Entry Name
ETFD_MOUSE

Uniprot Description

ETFDH: Accepts electrons from ETF and reduces ubiquinone. Defects in ETFDH are the cause of glutaric aciduria type 2C (GA2C). GA2C is an autosomal recessively inherited disorder of fatty acid, amino acid, and choline metabolism. It is characterized by multiple acyl-CoA dehydrogenase deficiencies resulting in large excretion not only of glutaric acid, but also of lactic, ethylmalonic, butyric, isobutyric, 2-methyl-butyric, and isovaleric acids. Belongs to the ETF-QO/FixC family.

Protein type: EC 1.5.5.1; Mitochondrial; Membrane protein, integral; Oxidoreductase

Cellular Component: mitochondrion; membrane; mitochondrial membrane; mitochondrial inner membrane; integral to mitochondrial inner membrane; mitochondrial electron transfer flavoprotein complex

Molecular Function: ubiquinone binding; electron carrier activity; 4 iron, 4 sulfur cluster binding; metal ion binding; iron-sulfur cluster binding; oxidoreductase activity; quinone binding; electron-transferring-flavoprotein dehydrogenase activity

Biological Process: transport; response to oxidative stress; fatty acid beta-oxidation using acyl-CoA dehydrogenase

Similar Products

Product Notes

The Etfdh etfdh (Catalog #AAA3239564) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Etfdh Peptide - middle region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Etfdh can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Etfdh etfdh for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EVLYHEDGSV KGIATNDVGI QKDGAPKTTF ERGLELHAKV TVFAEGCHGH. It is sometimes possible for the material contained within the vial of "Etfdh, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.