Efnb3 blocking peptide
Efnb3 Peptide - C-terminal region
Gene Names
Efnb3; Epl8; EFL-6; ELF-3; Elk-L3; LERK-8; NLERK-2
Reactivity
Mouse, Human
Applications
Western Blot
Synonyms
Efnb3; Efnb3 Peptide - C-terminal region; Efnb3 blocking peptide
Reactivity
Mouse, Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AGAGGAMCWRRRRAKPSESRHPGPGSFGRGGSLGLGGGGGMGPREAEPGE
Sequence Length
340
Applicable Applications for Efnb3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for Efnb3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-Efnb3 Antibody, made
Target Description: Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Efnb3 binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. It may play a pivotal role in forebrain function. It binds to, and induce the collapse of, commissural axons/growth cones in vitro. Efnb3 may play a role in constraining the orientation of longitudinally projecting axons.
Target Description: Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Efnb3 binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. It may play a pivotal role in forebrain function. It binds to, and induce the collapse of, commissural axons/growth cones in vitro. Efnb3 may play a role in constraining the orientation of longitudinally projecting axons.
Product Categories/Family for Efnb3 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
36kDa
NCBI Official Full Name
ephrin-B3
NCBI Official Synonym Full Names
ephrin B3
NCBI Official Symbol
Efnb3
NCBI Official Synonym Symbols
Epl8; EFL-6; ELF-3; Elk-L3; LERK-8; NLERK-2
NCBI Protein Information
ephrin-B3
UniProt Protein Name
Ephrin-B3
Protein Family
UniProt Gene Name
Efnb3
UniProt Entry Name
EFNB3_MOUSE
Research Articles on Efnb3
Similar Products
Product Notes
The Efnb3 efnb3 (Catalog #AAA3241065) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The Efnb3 Peptide - C-terminal region reacts with Mouse, Human and may cross-react with other species as described in the data sheet. AAA Biotech's Efnb3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the Efnb3 efnb3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: AGAGGAMCWR RRRAKPSESR HPGPGSFGRG GSLGLGGGGG MGPREAEPGE. It is sometimes possible for the material contained within the vial of "Efnb3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
