Ephrin-B3 Recombinant Protein | Efnb3 recombinant protein

Recombinant Mouse Ephrin-B3

Cat. Num. AAA1044476

• Gene Names: Efnb3; Epl8; EFL-6; ELF-3; Elk-L3; LERK-8; NLERK-2
• Purity: Greater or equal to 85% purity as determined by SDS-PAGE.
• Synonyms: Ephrin-B3; Recombinant Mouse Ephrin-B3; Efnb3 recombinant protein

• Host: E Coli or Yeast or Baculovirus or Mammalian Cell
• Purity/Purification: Greater or equal to 85% purity as determined by SDS-PAGE.
• Form/Format: Lyophilized or liquid (Format to be determined during the manufacturing process)
• Sequence Positions: 28-227aa; Extracellular Domain
• Sequence: LSLEPVYWNSANKRFQAEGGYVLYPQIGDRLDLLCPRARPPGPHSSPSYEFYKLYLVEGAQGRRCEAPPAPNLLLTCDRPDLDLRFTIKFQEYSPNLWGHEFRSHHDYYIIATSDGTREGLESLQGGVCLTRGMKVLLRVGQSPRGGAVPRKPVSEMPMERDRGAAHSAEPGRDTIPGDPSSNATSRGAEGPLPPPSMPA
• Sequence Length: 340

• Preparation and Storage: Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

Related Product Information for Efnb3 recombinant protein

Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons.

References

Ephrin-B3, a ligand for the receptor EphB3, expressed at the midline of the developing neural tube.Bergemann A.D., Zhang L., Chiang M.-K., Brambilla R., Klein R., Flanagan J.G.Oncogene 16:471-480(1998) Complementary expression of transmembrane ephrins and their receptors in the mouse spinal cord a possible role in constraining the orientation of longitudinally projecting axons.Imondi R., Wideman C., Kaprielian Z.Development 127:1397-1410(2000) Mass-spectrometric identification and relative quantification of N-linked cell surface glycoproteins.Wollscheid B., Bausch-Fluck D., Henderson C., O'Brien R., Bibel M., Schiess R., Aebersold R., Watts J.D.Nat. Biotechnol. 27:378-386(2009)

NCBI and Uniprot Product Information

• NCBI GI #: 6681281
• NCBI GeneID: 13643
• NCBI Accession #: NP_031937.1
• NCBI GenBank Nucleotide #: NM_007911.5
• UniProt Accession #: O35393
• Molecular Weight: 24 kDa
• NCBI Official Full Name: ephrin-B3
• NCBI Official Synonym Full Names: ephrin B3
• NCBI Official Symbol: Efnb3
• NCBI Official Synonym Symbols: Epl8; EFL-6; ELF-3; Elk-L3; LERK-8; NLERK-2
• NCBI Protein Information: ephrin-B3
• UniProt Protein Name: Ephrin-B3
• Protein Family: Ephrin
• UniProt Gene Name: Efnb3
• UniProt Entry Name: EFNB3_MOUSE

Uniprot Description

EFNB3: Cell surface transmembrane ligand for Eph receptors, a family of receptor tyrosine kinases which are crucial for migration, repulsion and adhesion during neuronal, vascular and epithelial development. Binds promiscuously Eph receptors residing on adjacent cells, leading to contact-dependent bidirectional signaling into neighboring cells. The signaling pathway downstream of the receptor is referred to as forward signaling while the signaling pathway downstream of the ephrin ligand is referred to as reverse signaling. May play a pivotal role in forebrain function. Binds to, and induce the collapse of, commissural axons/growth cones in vitro. May play a role in constraining the orientation of longitudinally projecting axons. Belongs to the ephrin family.

Protein type: Membrane protein, integral; Ligand, receptor tyrosine kinase; Cell development/differentiation

Cellular Component: integral to membrane; membrane; plasma membrane

Molecular Function: ephrin receptor binding

Biological Process: adult walking behavior; axon choice point recognition; axon guidance; cell differentiation; ephrin receptor signaling pathway; multicellular organismal development; nervous system development; T cell costimulation