Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant protein Human IL-25/IL-17E was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 20 kDa.)

IL-25/IL-17E Active Protein | IL-25 active protein

Recombinant Human IL-25/IL-17E Protein

Gene Names
IL25; IL17E
Purity
>95% by SDS-PAGE.
Synonyms
IL-25/IL-17E; Recombinant Human IL-25/IL-17E Protein; IL17E; IL-25 active protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20 mM Tris, 150 mM NaCl 1 mM EDTA, pH8.0.
Sequence
YSHWPSCCPSKGQDTSEELLRWSTVPVPPLEPARPNRHPESCRASEDGPLNSRAISPWRYELDRDLNRLPQDLYHARCLCPHCVSLQTGSHMDPRGNSELLYHNQTVFYRRPCHGEKGTHKGYCLERRLYRVSLACVCVRPRVMG
Sequence Length
161
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to induce CXCL1/GRO alpha secretion in HT-29 human colon adenocarcinoma cells. The ED50 for this effect is 0.25-1.5 ng/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human IL-25/IL-17E was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 20 kDa.)

SDS-Page (Recombinant protein Human IL-25/IL-17E was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 20 kDa.)
Related Product Information for IL-25 active protein
Description: Recombinant Human IL-25/IL-17E Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Tyr33-Gly177) of human IL-25/IL-17E (Accession #Q9H293) fused with a 6xHis tag at the C-terminus.

Background: This protein is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. Studies of a similar gene in mice suggest that this cytokine may be a pro-inflammatory cytokine favoring the Th2-type immune response. Alternative splicing results in multiple transcript variants.
Product Categories/Family for IL-25 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
interleukin-25 isoform 2
NCBI Official Synonym Full Names
interleukin 25
NCBI Official Symbol
IL25
NCBI Official Synonym Symbols
IL17E
NCBI Protein Information
interleukin-25
UniProt Protein Name
Interleukin-25
UniProt Gene Name
IL25
UniProt Synonym Gene Names
IL17E; IL-25; IL-17E
UniProt Entry Name
IL25_HUMAN

NCBI Description

The protein encoded by this gene is a cytokine that shares sequence similarity with interleukin 17. This cytokine can induce NF-kappaB activation, and stimulate the production of interleukin 8. Both this cytokine and interleukin 17B are ligands for the cytokine receptor IL17BR. Studies of a similar gene in mice suggest that this cytokine may be a pro-inflammatory cytokine favoring the Th2-type immune response. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2010]

Uniprot Description

IL25: Induces activation of NF-kappa-B and stimulates production of the proinflammatory chemokine IL-8. Proinflammatory cytokine favoring Th2-type immune responses. Belongs to the IL-17 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Secreted; Secreted, signal peptide; Cytokine

Chromosomal Location of Human Ortholog: 14q11.2

Cellular Component: extracellular space

Molecular Function: cytokine activity; interleukin-17E receptor binding

Biological Process: response to fungus; inflammatory response to antigenic stimulus; response to nematode; eosinophil differentiation; positive regulation of transcription from RNA polymerase II promoter

Research Articles on IL-25

Similar Products

Product Notes

The IL-25 il25 (Catalog #AAA9139839) is an Active Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: YSHWPSCCPS KGQDTSEELL RWSTVPVPPL EPARPNRHPE SCRASEDGPL NSRAISPWRY ELDRDLNRLP QDLYHARCLC PHCVSLQTGS HMDPRGNSEL LYHNQTVFYR RPCHGEKGTH KGYCLERRLY RVSLACVCVR PRVMG. It is sometimes possible for the material contained within the vial of "IL-25/IL-17E, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.