Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-Page (Recombinant protein Human CXCL1/GRO was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 10 kDa.)

CXCL1/GRO Active Protein | CXCL1 active protein

Recombinant Human CXCL1/GRO Protein

Gene Names
CXCL1; FSP; GRO1; GROa; MGSA; NAP-3; SCYB1; MGSA-a
Purity
>95% by SDS-PAGE.
Synonyms
CXCL1/GRO; Recombinant Human CXCL1/GRO Protein; FSP; GRO1; GROa; MGSA; MGSA-a; NAP-3; SCYB1; CXCL1 active protein
Ordering
For Research Use Only!
Host
Human Cells
Purity/Purification
>95% by SDS-PAGE.
Form/Format
Lyophilized from a 0.2 um filtered solution of 20 mM PB, 150 mM NaCl, 5% Trehalose, pH 7.4.
Sequence
ASVATELRCQCLQTLQGIHPKNIQSVNVKSPGPHCAQTEVIATLKNGRKACLNPASPIVKKIIEKMLNSDKSN
Sequence Length
107
Species
Human
Endotoxin
< 1 EU/ug of the protein by LAL method.
Biological Activity
Measured by its ability to induce myeloperoxidase release from cytochalasin B-treated human neutrophils. The ED50 for this effect is 0.15-0.3 ug/mL.
Reconstitution
Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
Tag
6xHis tag at the C-terminus
Preparation and Storage
Store the lyophilized protein at -20 degree C to -80 degree C for long term.
After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human CXCL1/GRO was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 10 kDa.)

SDS-Page (Recombinant protein Human CXCL1/GRO was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 10 kDa.)
Related Product Information for CXCL1 active protein
Description: Recombinant Human CXCL1/GRO Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL1/GRO (Accession #P09341) fused with a 6xHis tag at the C-terminus.

Background: This antimicrobial protein belongs a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4.
Product Categories/Family for CXCL1 active protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
growth-regulated alpha protein
NCBI Official Synonym Full Names
C-X-C motif chemokine ligand 1
NCBI Official Symbol
CXCL1
NCBI Official Synonym Symbols
FSP; GRO1; GROa; MGSA; NAP-3; SCYB1; MGSA-a
NCBI Protein Information
growth-regulated alpha protein
UniProt Protein Name
Growth-regulated alpha protein
UniProt Gene Name
CXCL1
UniProt Synonym Gene Names
GRO; GRO1; GROA; MGSA; SCYB1; MGSA; NAP-3
UniProt Entry Name
GROA_HUMAN

NCBI Description

This antimicrobial gene encodes a member of the CXC subfamily of chemokines. The encoded protein is a secreted growth factor that signals through the G-protein coupled receptor, CXC receptor 2. This protein plays a role in inflammation and as a chemoattractant for neutrophils. Aberrant expression of this protein is associated with the growth and progression of certain tumors. A naturally occurring processed form of this protein has increased chemotactic activity. Alternate splicing results in coding and non-coding variants of this gene. A pseudogene of this gene is found on chromosome 4. [provided by RefSeq, Sep 2014]

Uniprot Description

CXCL1: Has chemotactic activity for neutrophils. May play a role in inflammation and exerts its effects on endothelial cells in an autocrine fashion. In vitro, the processed forms GRO- alpha(4-73), GRO-alpha(5-73) and GRO-alpha(6-73) show a 30-fold higher chemotactic activity. Belongs to the intercrine alpha (chemokine CxC) family.

Protein type: Secreted; Motility/polarity/chemotaxis; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q21

Cellular Component: extracellular space; extracellular region

Molecular Function: growth factor activity; chemokine activity; CXCR chemokine receptor binding; enzyme activator activity; receptor binding

Biological Process: positive regulation of catalytic activity; negative regulation of cell proliferation; cell proliferation; nervous system development; G-protein coupled receptor protein signaling pathway; immune response; response to lipopolysaccharide; positive regulation of leukocyte chemotaxis; inflammatory response; actin cytoskeleton organization and biogenesis; chemotaxis; signal transduction

Research Articles on CXCL1

Similar Products

Product Notes

The CXCL1 cxcl1 (Catalog #AAA9139778) is an Active Protein produced from Human Cells and is intended for research purposes only. The product is available for immediate purchase. The amino acid sequence is listed below: ASVATELRCQ CLQTLQGIHP KNIQSVNVKS PGPHCAQTEV IATLKNGRKA CLNPASPIVK KIIEKMLNSD KSN. It is sometimes possible for the material contained within the vial of "CXCL1/GRO, Active Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.