BMPR-II/PPH1/BMPR2 Active Protein | BMPR-II active protein

Recombinant Human BMPR-II/PPH1/BMPR2 Protein

Cat. Num. AAA9139744

• Gene Names: BMPR2; BMR2; PPH1; BMPR3; BRK-3; POVD1; T-ALK; BMPR-II
• Purity: >95% by SDS-PAGE.
• Synonyms: BMPR-II/PPH1/BMPR2; Recombinant Human BMPR-II/PPH1/BMPR2 Protein; BMPR-II; BMPR3; BMR2; BRK-3; POVD1; PPH1; T-ALK; BMPR-II active protein

• Host: Human Cells
• Purity/Purification: >95% by SDS-PAGE.
• Form/Format: Lyophilized from a 0.2 um filtered solution of 20 mM PB, 150 mM NaCl, pH 7.4.
• Sequence: SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETI
• Sequence Length: 1038

• Species: Human
• Endotoxin: < 1 EU/ug of the protein by LAL method.
• Biological Activity: Measured by its binding ability in a functional ELISA. When Recombinant Mouse GDF-9 is immobilized at 2 ug/mL (100 uL/well), the concentration of Recombinant Human BMPR-II/PPH1/BMPR2 that produces 50% of the optimal binding response is found to be approximately 0.1 - 0.5 ug/mL.
• Reconstitution: Reconstitute to a concentration of 0.1-0.5 mg/mL in sterile distilled water.
• Tag: 6xHis tag at the C-terminus
• Preparation and Storage: Store the lyophilized protein at -20 degree C to -80 degree C for long term.; After reconstitution, the protein solution is stable at -20 degree C for 3 months, at 2-8 degree C for up to 1 week.

SDS-Page

(Recombinant protein Human BMPR-II/PPH1/BMPR2 was determined by SDS-PAGE under reducing conditions with Coomassie Blue, showing a band at 30 kDa.)

Related Product Information for BMPR-II active protein

Description: Recombinant Human BMPR-II/PPH1/BMPR2 Protein is produced by Human Cell expression system. The target protein is expressed with sequence (Ser27-Ile151) of human BMPR-II/PPH1/BMPR2 (Accession #Q13873) fused with a 6xHis tag at the C-terminus.

Background: This protein belongs a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are BMPs, which are members of the TGF-beta superfamily. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of two different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Type II receptors bind ligands in the absence of type I receptors, but they require their respective type I receptors for signaling, whereas type I receptors require their respective type II receptors for ligand binding. Mutations in this gene have been associated with primary pulmonary hypertension, both familial and fenfluramine-associated, and with pulmonary venoocclusive disease.

Product Categories/Family for BMPR-II active protein

Cytokines & Cytokine Receptors

NCBI and Uniprot Product Information

• NCBI GI #: 15451916
• NCBI GeneID: 659
• NCBI Accession #: NP_001195.2
• NCBI GenBank Nucleotide #: NP_001195.2
• UniProt Accession #: Q13873
• NCBI Official Full Name: bone morphogenetic protein receptor type-2
• NCBI Official Synonym Full Names: bone morphogenetic protein receptor type 2
• NCBI Official Symbol: BMPR2
• NCBI Official Synonym Symbols: BMR2; PPH1; BMPR3; BRK-3; POVD1; T-ALK; BMPR-II
• NCBI Protein Information: bone morphogenetic protein receptor type-2
• UniProt Protein Name: Bone morphogenetic protein receptor type-2
• UniProt Gene Name: BMPR2
• UniProt Synonym Gene Names: PPH1; BMP type-2 receptor; BMPR-2; BMP type II receptor; BMPR-II
• UniProt Entry Name: BMPR2_HUMAN

NCBI Description

This gene encodes a member of the bone morphogenetic protein (BMP) receptor family of transmembrane serine/threonine kinases. The ligands of this receptor are members of the TGF-beta superfamily. BMPs are involved in endochondral bone formation and embryogenesis. These proteins transduce their signals through the formation of heteromeric complexes of two different types of serine (threonine) kinase receptors: type I receptors of about 50-55 kD and type II receptors of about 70-80 kD. Mutations in this gene have been associated with primary pulmonary hypertension, both familial and fenfluramine-associated, and with pulmonary venoocclusive disease. [provided by RefSeq, May 2020]

Uniprot Description

BMPR2: a serine/threonine-protein kinase receptor for bone morphogenetic protein (BMP). Binds to BMP-7, BMP-2 and, less efficiently, BMP-4. Binding is weak but enhanced by the presence of type I receptors for BMPs. On ligand binding, forms a receptor complex consisting of two type II and two type I transmembrane serine/threonine kinases. Type II receptors phosphorylate and activate type I receptors which autophosphorylate, then bind and activate SMAD transcriptional regulators. Defects in BMPR2 are the cause of primary pulmonary hypertension (PPH1), a weakly penetrant dominant disorder, associated with lesions in pulmonary arterioles, elevated pulmonary arterial pressure, and right ventricular failure.

Protein type: EC 2.7.11.30; Kinase, protein; Cell cycle regulation; Protein kinase, TKL; Membrane protein, integral; Protein kinase, Ser/Thr (receptor); TKL group; STKR family; Type2 subfamily

Chromosomal Location of Human Ortholog: 2q33-q34

Cellular Component: extracellular space; cell surface; cell soma; integral to plasma membrane; apical plasma membrane; dendrite; cytoplasm; plasma membrane; basal plasma membrane; caveola

Molecular Function: transforming growth factor beta receptor activity; protein binding; growth factor binding; metal ion binding; activin receptor activity, type II; ATP binding; receptor signaling protein serine/threonine kinase activity

Biological Process: limb development; transcription from RNA polymerase II promoter; regulation of lung blood pressure; activin receptor signaling pathway; protein amino acid phosphorylation; anterior/posterior pattern formation; BMP signaling pathway; proteoglycan biosynthetic process; lymphangiogenesis; transmembrane receptor protein serine/threonine kinase signaling pathway; positive regulation of BMP signaling pathway; negative regulation of systemic arterial blood pressure; chondrocyte development; positive regulation of bone mineralization; cellular response to starvation; negative regulation of vasoconstriction; regulation of cell proliferation; positive regulation of osteoblast differentiation; mesoderm formation; positive regulation of axon extension involved in axon guidance; positive regulation of endothelial cell proliferation; blood vessel remodeling; brain development; negative regulation of cell growth; vascular endothelial growth factor receptor signaling pathway; alveolus development

Disease: Pulmonary Venoocclusive Disease 1, Autosomal Dominant; Pulmonary Hypertension, Primary, 1