Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

ZMIZ1 blocking peptide

ZMIZ1 Peptide-N-terminal region

Reactivity
Human
Synonyms
ZMIZ1; ZMIZ1 Peptide-N-terminal region; zinc finger MIZ domain-containing protein 1; ZMIZ1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
QSLMGCLTVVSRVAAQQGFDLDLGYRLLAVCAANRDKFTPKSAALLSSWC
Quality Control
The peptide is characterized by mass spectroscopy
Protein Size
1067 amino acids
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for ZMIZ1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-ZMIZ1 Antibody. It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Description of Target: This gene encodes a member of the PIAS (protein inhibitor of activated STAT) family of proteins. The encoded protein regulates the activity of various transcription factors, including the androgen receptor, Smad3/4, and p53. The encoded protein may also play a role in sumoylation. A translocation between this locus on chromosome 10 and the protein tyrosine kinase ABL1 locus on chromosome 9 has been associated with acute lymphoblastic leukemia.

NCBI and Uniprot Product Information

NCBI GeneID
UniProt Accession #
Molecular Weight
115kDa
UniProt Protein Name
Zinc finger MIZ domain-containing protein 1
UniProt Gene Name
ZMIZ1
UniProt Synonym Gene Names
KIAA1224; RAI17; ZIMP10
UniProt Entry Name
ZMIZ1_HUMAN

Uniprot Description

RAI17: Increases ligand-dependent transcriptional activity of AR and promotes AR sumoylation. The stimulation of AR activity is dependent upon sumoylation. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription, coactivator/corepressor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 10q22.3

Cellular Component: nucleoplasm; intracellular membrane-bound organelle; cytoplasm; nuclear speck

Molecular Function: zinc ion binding

Biological Process: heart morphogenesis; developmental growth; positive regulation of fibroblast proliferation; transcription, DNA-dependent; in utero embryonic development; vitellogenesis; artery morphogenesis; cell aging; positive regulation of transcription from RNA polymerase II promoter; vasculogenesis

Similar Products

Product Notes

The ZMIZ1 zmiz1 (Catalog #AAA3249298) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The ZMIZ1 Peptide-N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: QSLMGCLTVV SRVAAQQGFD LDLGYRLLAV CAANRDKFTP KSAALLSSWC. It is sometimes possible for the material contained within the vial of "ZMIZ1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.