Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

USP30 blocking peptide

USP30 Peptide - middle region

Reactivity
Human
Applications
Western Blot
Synonyms
USP30; USP30 Peptide - middle region; USP30 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
SCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQPRVTHLFDVH
Sequence Length
508
Applicable Applications for USP30 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for USP30 blocking peptide
This is a synthetic peptide designed for use in combination with anti-USP30 Antibody, made

Target Description: USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]).
Product Categories/Family for USP30 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
57kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 30 isoform 1
NCBI Official Synonym Full Names
ubiquitin specific peptidase 30
NCBI Official Symbol
USP30
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 30
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 30
UniProt Gene Name
USP30
UniProt Synonym Gene Names
Ub-specific protease 30
UniProt Entry Name
UBP30_HUMAN

NCBI Description

USP30, a member of the ubiquitin-specific protease family (see USP1, MIM 603478), is a novel mitochondrial deubiquitinating (DUB) enzyme (Nakamura and Hirose, 2008 [PubMed 18287522]).[supplied by OMIM, Dec 2008]

Uniprot Description

USP30: May participate in the maintenance of mitochondrial morphology. Belongs to the peptidase C19 family.

Protein type: Membrane protein, integral; EC 3.4.19.12; Protease; Ubiquitin-specific protease

Chromosomal Location of Human Ortholog: 12q24.11

Cellular Component: mitochondrial outer membrane; mitochondrion; integral to membrane

Molecular Function: cysteine-type endopeptidase activity; ubiquitin-specific protease activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; protein deubiquitination; mitochondrial fusion; mitochondrion degradation

Research Articles on USP30

Similar Products

Product Notes

The USP30 usp30 (Catalog #AAA3234743) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The USP30 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's USP30 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the USP30 usp30 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: SCLLDVLRMY RWQISSFEEQ DAHELFHVIT SSLEDERDRQ PRVTHLFDVH. It is sometimes possible for the material contained within the vial of "USP30, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.