Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

USP25 blocking peptide

USP25 Peptide - N-terminal region

Gene Names
USP25; USP21
Reactivity
Human
Synonyms
USP25; USP25 Peptide - N-terminal region; USP25 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: AISRVLEASIAENKACLKRTPTEVWRDSRNPYDRKRQDKAPVGLKNVGNT
Sequence Length
1125
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for USP25 blocking peptide
This is a synthetic peptide designed for use in combination with anti- USP25 Antibody, made

Target Description: Ubiquitin is a highly conserved 76-amino acid protein involved in regulation of intracellular protein breakdown, cell cycle regulation, and stress response. Ubiquitin is released from degraded proteins by disassembly of the polyubiquitin chains, which is mediated by ubiquitin-specific proteases (USPs), such as USP25.
Product Categories/Family for USP25 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
123 kDa
NCBI Official Full Name
ubiquitin carboxyl-terminal hydrolase 25 isoform USP25m
NCBI Official Synonym Full Names
ubiquitin specific peptidase 25
NCBI Official Symbol
USP25
NCBI Official Synonym Symbols
USP21
NCBI Protein Information
ubiquitin carboxyl-terminal hydrolase 25
UniProt Protein Name
Ubiquitin carboxyl-terminal hydrolase 25
UniProt Gene Name
USP25
UniProt Synonym Gene Names
USP21
UniProt Entry Name
UBP25_HUMAN

NCBI Description

Ubiquitin (MIM 191339) is a highly conserved 76-amino acid protein involved in regulation of intracellular protein breakdown, cell cycle regulation, and stress response. Ubiquitin is released from degraded proteins by disassembly of the polyubiquitin chains, which is mediated by ubiquitin-specific proteases (USPs), such as USP25 (Valero et al., 1999 [PubMed 10644437]).[supplied by OMIM, Mar 2008]

Uniprot Description

USP25: Deubiquitinating enzyme that hydrolyzes ubiquitin moieties conjugated to substrates and thus, functions to process newly synthesized Ubiquitin, to recycle ubiquitin molecules or to edit polyubiquitin chains and prevents proteasomal degradation of substrates. Hydrolyzes both 'Lys-48'- and 'Lys-63'-linked tetraubiquitin chains. Belongs to the peptidase C19 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Ubiquitin conjugating system; Protease; Ubiquitin-specific protease; EC 3.4.19.12

Chromosomal Location of Human Ortholog: 21q11.2

Cellular Component: cytoplasm; nucleus

Molecular Function: peptidase activity; protein binding; SUMO binding; cysteine-type endopeptidase activity; ubiquitin-specific protease activity

Biological Process: proteasomal ubiquitin-dependent protein catabolic process; protein modification process; proteolysis

Research Articles on USP25

Similar Products

Product Notes

The USP25 usp25 (Catalog #AAA3248073) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The USP25 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: AISRVLEASI AENKACLKRT PTEVWRDSRN PYDRKRQDKA PVGLKNVGNT. It is sometimes possible for the material contained within the vial of "USP25, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.