Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TRIO blocking peptide

TRIO Peptide - C-terminal region

Gene Names
TRIO; tgat; MEBAS; MRD44; ARHGEF23
Reactivity
Human
Applications
Western Blot
Synonyms
TRIO; TRIO Peptide - C-terminal region; TRIO blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: PGFVLGHTSAVIVENPDGTLKKSTSWHTALRLRKKSEKKDKDGKREGKLE
Sequence Length
596
Applicable Applications for TRIO blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TRIO blocking peptide
This is a synthetic peptide designed for use in combination with anti-TRIO Antibody, made

Target Description: TRIO promotes the exchange of GDP by GTP. Together with leukocyte antigen-related (LAR) protein, it could play a role in coordinating cell-matrix and cytoskeletal rearrangements necessary for cell migration and cell growth.
Product Categories/Family for TRIO blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
65kDa
NCBI Official Full Name
triple functional domain protein
NCBI Official Synonym Full Names
trio Rho guanine nucleotide exchange factor
NCBI Official Symbol
TRIO
NCBI Official Synonym Symbols
tgat; MEBAS; MRD44; ARHGEF23
NCBI Protein Information
triple functional domain protein
UniProt Protein Name
Triple functional domain protein
Protein Family
UniProt Gene Name
TRIO
UniProt Entry Name
TRIO_HUMAN

NCBI Description

This gene encodes a large protein that functions as a GDP to GTP exchange factor. This protein promotes the reorganization of the actin cytoskeleton, thereby playing a role in cell migration and growth. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]

Uniprot Description

TRIO: Promotes the exchange of GDP by GTP. Together with leukocyte antigen-related (LAR) protein, it could play a role in coordinating cell-matrix and cytoskeletal rearrangements necessary for cell migration and cell growth. Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: Kinase, protein; Apoptosis; EC 2.7.11.1; GEFs, misc.; Protein kinase, Ser/Thr (non-receptor); Protein kinase, CAMK; GEFs; CAMK group; Trio family

Chromosomal Location of Human Ortholog: 5p15.2

Cellular Component: cytosol

Molecular Function: ATP binding; enzyme binding; guanyl-nucleotide exchange factor activity; protein binding; protein serine/threonine kinase activity; Rho guanyl-nucleotide exchange factor activity

Biological Process: positive regulation of apoptosis; positive regulation of GTPase activity; protein amino acid phosphorylation; regulation of Rho protein signal transduction; regulation of small GTPase mediated signal transduction; transmembrane receptor protein tyrosine phosphatase signaling pathway

Research Articles on TRIO

Similar Products

Product Notes

The TRIO trio (Catalog #AAA3234944) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TRIO Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TRIO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TRIO trio for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PGFVLGHTSA VIVENPDGTL KKSTSWHTAL RLRKKSEKKD KDGKREGKLE. It is sometimes possible for the material contained within the vial of "TRIO, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.