TRIM71 blocking peptide

TRIM71 Peptide - C-terminal region

Cat. Num. AAA3242537

• Gene Names: TRIM71; LIN41; LIN-41
• Reactivity: Human
• Applications: Western Blot
• Synonyms: TRIM71; TRIM71 Peptide - C-terminal region; TRIM71 blocking peptide

• Reactivity: Human
• Form/Format: Lyophilized powder
• Sequence: ARFLGSEGTGNGQFLRPQGVAVDQEGRIIVADSRNHRVQMFESNGSFLCK
• Sequence Length: 868

• Applicable Applications for TRIM71 blocking peptide: Western Blot (WB)
• Preparation and Storage: Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.

Related Product Information for TRIM71 blocking peptide

This is a synthetic peptide designed for use in combination with anti-TRIM71 Antibody, made

Target Description: TRIM71 may be involved in controlling the timing of organ formation during development.

Product Categories/Family for TRIM71 blocking peptide

Peptide

NCBI and Uniprot Product Information

• NCBI GI #: 84993742
• NCBI GeneID: 131405
• NCBI Accession #: NP_001034200
• NCBI GenBank Nucleotide #: NM_001039111
• UniProt Accession #: Q2Q1W2
• Molecular Weight: 95kDa
• NCBI Official Full Name: E3 ubiquitin-protein ligase TRIM71
• NCBI Official Synonym Full Names: tripartite motif containing 71
• NCBI Official Symbol: TRIM71
• NCBI Official Synonym Symbols: LIN41; LIN-41
• NCBI Protein Information: E3 ubiquitin-protein ligase TRIM71
• UniProt Protein Name: E3 ubiquitin-protein ligase TRIM71
• Protein Family: E3 ubiquitin-protein ligase
• UniProt Gene Name: TRIM71
• UniProt Synonym Gene Names: LIN41
• UniProt Entry Name: LIN41_HUMAN

NCBI Description

The protein encoded by this gene is an E3 ubiquitin-protein ligase that binds with miRNAs and maintains the growth and upkeep of embryonic stem cells. This gene also is involved in the G1-S phase transition of the cell cycle. [provided by RefSeq, Dec 2015]

Uniprot Description

TRIM71: May be involved in controlling the timing of organ formation during development. Belongs to the TRIM/RBCC family.

Chromosomal Location of Human Ortholog: 3p22.3

Molecular Function: miRNA binding; zinc ion binding; ubiquitin-protein ligase activity; ligase activity

Biological Process: neural tube development; protein autoubiquitination; fibroblast growth factor receptor signaling pathway; neural tube closure; miRNA-mediated gene silencing, negative regulation of translation; G1/S transition of mitotic cell cycle