Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

TIAM2 blocking peptide

TIAM2 Peptide - middle region

Gene Names
TIAM2; STEF; TIAM-2
Reactivity
Human
Applications
Western Blot
Synonyms
TIAM2; TIAM2 Peptide - middle region; TIAM2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: NDSQANGMEGPRENQDPPPRSLARHLSDADRLRKVIQELVDTEKSYVKDL
Sequence Length
167
Applicable Applications for TIAM2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for TIAM2 blocking peptide
This gene encodes a guanine nucleotide exchange factor. A highly similar mouse protein specifically activates ras-related C3 botulinum substrate 1, converting this Rho-like guanosine triphosphatase (GTPase) from a guanosine diphosphate-bound inactive state to a guanosine triphosphate-bound active state. The encoded protein may play a role in neural cell development. Alternatively spliced transcript variants encoding different isoforms have been described.
Product Categories/Family for TIAM2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
190 kDa
NCBI Official Full Name
T-lymphoma invasion and metastasis-inducing protein 2 isoform b
NCBI Official Synonym Full Names
T cell lymphoma invasion and metastasis 2
NCBI Official Symbol
TIAM2
NCBI Official Synonym Symbols
STEF; TIAM-2
NCBI Protein Information
T-lymphoma invasion and metastasis-inducing protein 2
UniProt Protein Name
T-lymphoma invasion and metastasis-inducing protein 2
UniProt Gene Name
TIAM2
UniProt Synonym Gene Names
KIAA2016; STEF; TIAM-2
UniProt Entry Name
TIAM2_HUMAN

NCBI Description

This gene encodes a guanine nucleotide exchange factor. A highly similar mouse protein specifically activates ras-related C3 botulinum substrate 1, converting this Rho-like guanosine triphosphatase (GTPase) from a guanosine diphosphate-bound inactive state to a guanosine triphosphate-bound active state. The encoded protein may play a role in neural cell development. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

TIAM2: Modulates the activity of RHO-like proteins and connects extracellular signals to cytoskeletal activities. Acts as a GDP-dissociation stimulator protein that stimulates the GDP-GTP exchange activity of RHO-like GTPases and activates them. Mediates extracellular laminin signals to activate Rac1, contributing to neurite growth. Involved in lamellipodial formation and advancement of the growth cone of embryonic hippocampal neurons. Promotes migration of neurons in the cerebral cortex. When overexpressed, induces membrane ruffling accompanied by the accumulation of actin filaments along the altered plasma membrane. Activates specifically RAC1, but not CDC42 and RHOA. Belongs to the TIAM family. 5 isoforms of the human protein are produced by alternative splicing.

Protein type: GEFs; GEFs, Rac/Rho; Apoptosis

Chromosomal Location of Human Ortholog: 6q25.2

Cellular Component: growth cone; membrane; lamellipodium; cytosol; filopodium

Molecular Function: Rho guanyl-nucleotide exchange factor activity; guanyl-nucleotide exchange factor activity; receptor signaling protein activity; GTPase activator activity

Biological Process: regulation of small GTPase mediated signal transduction; nerve growth factor receptor signaling pathway; positive regulation of apoptosis; small GTPase mediated signal transduction; cellular lipid metabolic process

Research Articles on TIAM2

Similar Products

Product Notes

The TIAM2 tiam2 (Catalog #AAA3245419) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The TIAM2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's TIAM2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TIAM2 tiam2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: NDSQANGMEG PRENQDPPPR SLARHLSDAD RLRKVIQELV DTEKSYVKDL. It is sometimes possible for the material contained within the vial of "TIAM2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.