Immunohistochemistry (IHC)
(IHC Information: Paraffin embedded small intestine, submucosal plexus tissue, tested with an antibody Dilution of 5 ug/ml.)
Rabbit ZFP36 Polyclonal Antibody | anti-ZFP36 antibody
ZFP36 antibody - middle region
Gene Names
ZFP36; TTP; G0S24; GOS24; TIS11; NUP475; zfp-36; RNF162A
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
ZFP36; Polyclonal Antibody; ZFP36 antibody - middle region; anti-ZFP36 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSCRRATPISVWGPLGGLVRTPSVQSLGSDPDEYASSGSSLGGSDSPVFE
Sequence Length
326
Applicable Applications for anti-ZFP36 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 93%; Sheep: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZFP36
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(IHC Information: Paraffin embedded small intestine, submucosal plexus tissue, tested with an antibody Dilution of 5 ug/ml.)
Immunohistochemistry (IHC)
(IHC Information: Paraffin embedded small intestine, submucosal plexus tissue, tested with an antibody Dilution of 5 ug/ml.)
Western Blot (WB)
(WB Suggested Anti-ZFP36 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Western Blot (WB)
(WB Suggested Anti-ZFP36 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Lung)
Related Product Information for anti-ZFP36 antibody
This is a rabbit polyclonal antibody against ZFP36. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: ZFP36 is a probable regulatory protein with a novel zinc finger structure involved in regulating the response to growth factors. Knockdown of ZFP36 increased both cognate macrophage gene mRNAs and inflammatory tumor necrosis factor protein release. Overexpression of ZFP36 resulted in decreased levels of the same genes supporting its role in regulating macrophage gene expression. Multiple phosphorylation sites in ZFP36 in mammalian cells were reported. ZFP36 can be phosphorylated by JNK as well as by the other members of the greater MAP kinase family. Gene expression profiling predicts clinical outcome of prostate cancer. Inappropriate ZFP36 production may be one factor that contributes to higher rheumatoid arthritis disease activity.
Target Description: ZFP36 is a probable regulatory protein with a novel zinc finger structure involved in regulating the response to growth factors. Knockdown of ZFP36 increased both cognate macrophage gene mRNAs and inflammatory tumor necrosis factor protein release. Overexpression of ZFP36 resulted in decreased levels of the same genes supporting its role in regulating macrophage gene expression. Multiple phosphorylation sites in ZFP36 in mammalian cells were reported. ZFP36 can be phosphorylated by JNK as well as by the other members of the greater MAP kinase family. Gene expression profiling predicts clinical outcome of prostate cancer. Inappropriate ZFP36 production may be one factor that contributes to higher rheumatoid arthritis disease activity.
Product Categories/Family for anti-ZFP36 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
mRNA decay activator protein ZFP36
NCBI Official Synonym Full Names
ZFP36 ring finger protein
NCBI Official Symbol
ZFP36
NCBI Official Synonym Symbols
TTP; G0S24; GOS24; TIS11; NUP475; zfp-36; RNF162A
NCBI Protein Information
mRNA decay activator protein ZFP36
UniProt Protein Name
Tristetraprolin
Protein Family
UniProt Gene Name
ZFP36
UniProt Synonym Gene Names
G0S24; RNF162A; TIS11A; TTP; TTP; TIS11; Zfp-36
UniProt Entry Name
TTP_HUMAN
Research Articles on ZFP36
Similar Products
Product Notes
The ZFP36 zfp36 (Catalog #AAA3204009) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZFP36 antibody - middle region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's ZFP36 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the ZFP36 zfp36 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSCRRATPIS VWGPLGGLVR TPSVQSLGSD PDEYASSGSS LGGSDSPVFE. It is sometimes possible for the material contained within the vial of "ZFP36, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
