Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

THG1L blocking peptide

THG1L Peptide - middle region

Gene Names
THG1L; ICF45; IHG-1; hTHG1
Reactivity
Human
Synonyms
THG1L; THG1L Peptide - middle region; THG1L blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DGRVVVYPSNQTLKDYLSWRQADCHINNLYNTVFWALIQQSGLTPVQAQG
Sequence Length
298
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for THG1L blocking peptide
This is a synthetic peptide designed for use in combination with anti- THG1L Antibody, made

Target Description: The protein encoded by this gene is a mitochondrial protein that is induced by high levels of glucose and is associated with diabetic nephropathy. The encoded protein appears to increase mitochondrial biogenesis, which could lead to renal fibrosis. Another function of this protein is that of a guanyltransferase, adding GMP to the 5' end of tRNA(His). Several transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for THG1L blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
probable tRNA(His) guanylyltransferase isoform 1
NCBI Official Synonym Full Names
tRNA-histidine guanylyltransferase 1 like
NCBI Official Symbol
THG1L
NCBI Official Synonym Symbols
ICF45; IHG-1; hTHG1
NCBI Protein Information
probable tRNA(His) guanylyltransferase
UniProt Protein Name
Probable tRNA(His) guanylyltransferase
UniProt Gene Name
THG1L
UniProt Synonym Gene Names
ICF45
UniProt Entry Name
THG1_HUMAN

NCBI Description

The protein encoded by this gene is a mitochondrial protein that is induced by high levels of glucose and is associated with diabetic nephropathy. The encoded protein appears to increase mitochondrial biogenesis, which could lead to renal fibrosis. Another function of this protein is that of a guanyltransferase, adding GMP to the 5' end of tRNA(His). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Dec 2015]

Uniprot Description

ICF45: Adds a GMP to the 5'-end of tRNA(His) after transcription and RNase P cleavage. This step is essential for proper recognition of the tRNA and for the fidelity of protein synthesis. Belongs to the tRNA(His) guanylyltransferase family.

Protein type: EC 2.7.7.79; Cell cycle regulation; Mitochondrial; Transferase

Chromosomal Location of Human Ortholog: 5q33.3

Cellular Component: mitochondrion; cytoplasm

Molecular Function: identical protein binding; tRNA guanylyltransferase activity; GTP binding; magnesium ion binding; ATP binding; tRNA binding

Biological Process: tRNA processing; tRNA modification; protein homotetramerization

Research Articles on THG1L

Similar Products

Product Notes

The THG1L thg1l (Catalog #AAA3247637) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The THG1L Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: DGRVVVYPSN QTLKDYLSWR QADCHINNLY NTVFWALIQQ SGLTPVQAQG. It is sometimes possible for the material contained within the vial of "THG1L, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.