Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SYNPO blocking peptide

SYNPO Peptide - C-terminal region

Reactivity
Human
Synonyms
SYNPO; SYNPO Peptide - C-terminal region; SYNPO blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSSHTPELAR
Sequence Length
929
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SYNPO blocking peptide
This is a synthetic peptide designed for use in combination with anti-SYNPO Antibody, made

Target Description: Synaptopodin is an actin-associated protein that may play a role in actin-based cell shape and motility. The name synaptopodin derives from the protein's associations with postsynaptic densities and dendritic spines and with renal podocytes.
Product Categories/Family for SYNPO blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102kDa
NCBI Official Full Name
synaptopodin isoform B
NCBI Official Synonym Full Names
synaptopodin
NCBI Official Symbol
SYNPO
NCBI Protein Information
synaptopodin
UniProt Protein Name
Synaptopodin
Protein Family
UniProt Gene Name
SYNPO
UniProt Synonym Gene Names
KIAA1029
UniProt Entry Name
SYNPO_HUMAN

NCBI Description

Synaptopodin is an actin-associated protein that may play a role in actin-based cell shape and motility. The name synaptopodin derives from the protein's associations with postsynaptic densities and dendritic spines and with renal podocytes (Mundel et al., 1997 [PubMed 9314539]).[supplied by OMIM, Mar 2008]

Uniprot Description

SYNPO: an actin-associated protein that may play a role in modulating actin-based shape and motility of dendritic spines and renal podocyte foot processes. Seems to be essential for the formation of spine apparatuses in spines of telencephalic neurons, which is involved in synaptic plasticity.

Protein type: Actin-binding; Cytoskeletal

Chromosomal Location of Human Ortholog: 5q33.1

Cellular Component: postsynaptic membrane; tight junction; cytoplasm; postsynaptic density; dendritic spine; stress fiber; perikaryon; actin cytoskeleton

Molecular Function: protein binding; actin binding

Biological Process: regulation of stress fiber formation; positive regulation of actin filament bundle formation

Research Articles on SYNPO

Similar Products

Product Notes

The SYNPO synpo (Catalog #AAA3244853) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SYNPO Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPRIQAKPKP KPNQNLSEAS GKGAELYARR QSRMEKYVIE SSSHTPELAR. It is sometimes possible for the material contained within the vial of "SYNPO, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.