Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SYNPOSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit anti-Human SYNPO Polyclonal Antibody | anti-SYNPO antibody

SYNPO Antibody - C-terminal region

Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SYNPO; Polyclonal Antibody; SYNPO Antibody - C-terminal region; anti-SYNPO antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: SPRIQAKPKPKPNQNLSEASGKGAELYARRQSRMEKYVIESSSHTPELAR
Sequence Length
929
Applicable Applications for anti-SYNPO antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SYNPO
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SYNPOSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SYNPOSample Type: 293T Whole Cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-SYNPO antibody
This is a rabbit polyclonal antibody against SYNPO. It was validated on Western Blot

Target Description: Synaptopodin is an actin-associated protein that may play a role in actin-based cell shape and motility. The name synaptopodin derives from the protein's associations with postsynaptic densities and dendritic spines and with renal podocytes.
Product Categories/Family for anti-SYNPO antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
102kDa
NCBI Official Full Name
synaptopodin isoform B
NCBI Official Synonym Full Names
synaptopodin
NCBI Official Symbol
SYNPO
NCBI Protein Information
synaptopodin
UniProt Protein Name
Synaptopodin
Protein Family
UniProt Gene Name
SYNPO
UniProt Synonym Gene Names
KIAA1029
UniProt Entry Name
SYNPO_HUMAN

NCBI Description

Synaptopodin is an actin-associated protein that may play a role in actin-based cell shape and motility. The name synaptopodin derives from the protein's associations with postsynaptic densities and dendritic spines and with renal podocytes (Mundel et al., 1997 [PubMed 9314539]).[supplied by OMIM, Mar 2008]

Uniprot Description

SYNPO: an actin-associated protein that may play a role in modulating actin-based shape and motility of dendritic spines and renal podocyte foot processes. Seems to be essential for the formation of spine apparatuses in spines of telencephalic neurons, which is involved in synaptic plasticity.

Protein type: Actin-binding; Cytoskeletal

Chromosomal Location of Human Ortholog: 5q33.1

Cellular Component: postsynaptic membrane; tight junction; cytoplasm; postsynaptic density; dendritic spine; stress fiber; perikaryon; actin cytoskeleton

Molecular Function: protein binding; actin binding

Biological Process: regulation of stress fiber formation; positive regulation of actin filament bundle formation

Research Articles on SYNPO

Similar Products

Product Notes

The SYNPO synpo (Catalog #AAA3220011) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SYNPO Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SYNPO can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SYNPO synpo for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SPRIQAKPKP KPNQNLSEAS GKGAELYARR QSRMEKYVIE SSSHTPELAR. It is sometimes possible for the material contained within the vial of "SYNPO, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.