Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

STEAP1 blocking peptide

STEAP1 Peptide - N-terminal region

Gene Names
STEAP1; STEAP; PRSS24
Reactivity
Human
Applications
Western Blot
Synonyms
STEAP1; STEAP1 Peptide - N-terminal region; STEAP1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
FYKIPILVINKVLPMVSITLLALVYLPGVIAAIVQLHNGTKYKKFPHWLD
Sequence Length
339
Applicable Applications for STEAP1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for STEAP1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-STEAP1 Antibody, made

Target Description: This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions.
Product Categories/Family for STEAP1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
metalloreductase STEAP1
NCBI Official Synonym Full Names
STEAP family member 1
NCBI Official Symbol
STEAP1
NCBI Official Synonym Symbols
STEAP; PRSS24
NCBI Protein Information
metalloreductase STEAP1
UniProt Protein Name
Metalloreductase STEAP1
Protein Family
UniProt Gene Name
STEAP1
UniProt Synonym Gene Names
PRSS24; STEAP
UniProt Entry Name
STEA1_HUMAN

NCBI Description

This gene is predominantly expressed in prostate tissue, and is found to be upregulated in multiple cancer cell lines. The gene product is predicted to be a six-transmembrane protein, and was shown to be a cell surface antigen significantly expressed at cell-cell junctions. [provided by RefSeq, Jul 2008]

Uniprot Description

STEAP1: Metalloreductase that has the ability to reduce both Fe(3+) to Fe(2+) and Cu(2+) to Cu(1+). Uses NAD(+) as acceptor. Belongs to the STEAP family.

Protein type: Cell adhesion; EC 1.16.1.-; Membrane protein, multi-pass; Membrane protein, integral; Oxidoreductase

Chromosomal Location of Human Ortholog: 7q21

Cellular Component: membrane; integral to plasma membrane; plasma membrane; endosome membrane; intercellular junction

Molecular Function: transporter activity; channel activity; metal ion binding; oxidoreductase activity

Biological Process: iron ion homeostasis; ion transport; transmembrane transport

Research Articles on STEAP1

Similar Products

Product Notes

The STEAP1 steap1 (Catalog #AAA3228247) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The STEAP1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's STEAP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the STEAP1 steap1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: FYKIPILVIN KVLPMVSITL LALVYLPGVI AAIVQLHNGT KYKKFPHWLD. It is sometimes possible for the material contained within the vial of "STEAP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.