Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SNW1 blocking peptide

SNW1 Peptide - C-terminal region

Gene Names
SNW1; Bx42; SKIP; FUN20; Prp45; SKIIP; SKIP1; PRPF45; NCOA-62
Reactivity
Human
Applications
Western Blot
Synonyms
SNW1; SNW1 Peptide - C-terminal region; SNW1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEG
Sequence Length
536
Applicable Applications for SNW1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SNW1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SNW1 Antibody, made

Target Description: This gene, a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also function as a splicing factor by interacting with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity. Alternative splicing results in multiple transcript variants.
Product Categories/Family for SNW1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
SNW domain-containing protein 1 isoform 2
NCBI Official Synonym Full Names
SNW domain containing 1
NCBI Official Symbol
SNW1
NCBI Official Synonym Symbols
Bx42; SKIP; FUN20; Prp45; SKIIP; SKIP1; PRPF45; NCOA-62
NCBI Protein Information
SNW domain-containing protein 1
UniProt Protein Name
SNW domain-containing protein 1
UniProt Gene Name
SNW1
UniProt Synonym Gene Names
SKIIP; SKIP
UniProt Entry Name
SNW1_HUMAN

NCBI Description

This gene, a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also function as a splicing factor by interacting with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Uniprot Description

Skip: Involved in vitamin D-mediated transcription. Can function as a splicing factor in pre-mRNA splicing. Belongs to the SNW family.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor; Spliceosome

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: nucleoplasm; spliceosome; transcription elongation factor complex b; nuclear matrix; chromatin; nucleus

Molecular Function: protein binding; vitamin D receptor binding; retinoic acid receptor binding; transcription coactivator activity; Notch binding; SMAD binding; transcription corepressor activity; nuclear hormone receptor binding

Biological Process: retinoic acid receptor signaling pathway; transcription initiation from RNA polymerase II promoter; Notch signaling pathway; positive regulation of neurogenesis; viral reproduction; positive regulation of transforming growth factor beta receptor signaling pathway; negative regulation of transcription from RNA polymerase II promoter; positive regulation of histone H3-K4 methylation; positive regulation of nuclear mRNA splicing, via spliceosome; nuclear mRNA splicing, via spliceosome; regulation of transcription from RNA polymerase II promoter; gene expression; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; regulation of retinoic acid receptor signaling pathway

Research Articles on SNW1

Similar Products

Product Notes

The SNW1 snw1 (Catalog #AAA3244855) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SNW1 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNW1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNW1 snw1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDRRQRGREG PVQFEEDPFG LDKFLEEAKQ HGGSKRPSDS SRPKEHEHEG. It is sometimes possible for the material contained within the vial of "SNW1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.