Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SNW1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SNW1 Polyclonal Antibody | anti-SNW1 antibody

SNW1 Antibody - C-terminal region

Gene Names
SNW1; Bx42; SKIP; FUN20; Prp45; SKIIP; SKIP1; PRPF45; NCOA-62
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SNW1; Polyclonal Antibody; SNW1 Antibody - C-terminal region; anti-SNW1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 29% sucrose.
Sequence
Synthetic peptide located within the following region: SDRRQRGREGPVQFEEDPFGLDKFLEEAKQHGGSKRPSDSSRPKEHEHEG
Sequence Length
536
Applicable Applications for anti-SNW1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human SNW1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SNW1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SNW1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SNW1 antibody
This gene, a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also function as a splicing factor by interacting with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity. Alternative splicing results in multiple transcript variants.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
SNW domain-containing protein 1 isoform 2
NCBI Official Synonym Full Names
SNW domain containing 1
NCBI Official Symbol
SNW1
NCBI Official Synonym Symbols
Bx42; SKIP; FUN20; Prp45; SKIIP; SKIP1; PRPF45; NCOA-62
NCBI Protein Information
SNW domain-containing protein 1
UniProt Protein Name
SNW domain-containing protein 1
UniProt Gene Name
SNW1
UniProt Synonym Gene Names
SKIIP; SKIP
UniProt Entry Name
SNW1_HUMAN

NCBI Description

This gene, a member of the SNW gene family, encodes a coactivator that enhances transcription from some Pol II promoters. This coactivator can bind to the ligand-binding domain of the vitamin D receptor and to retinoid receptors to enhance vitamin D-, retinoic acid-, estrogen-, and glucocorticoid-mediated gene expression. It can also function as a splicing factor by interacting with poly(A)-binding protein 2 to directly control the expression of muscle-specific genes at the transcriptional level. Finally, the protein may be involved in oncogenesis since it interacts with a region of SKI oncoproteins that is required for transforming activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2016]

Uniprot Description

Skip: Involved in vitamin D-mediated transcription. Can function as a splicing factor in pre-mRNA splicing. Belongs to the SNW family.

Protein type: Nuclear receptor co-regulator; Transcription, coactivator/corepressor; Spliceosome

Chromosomal Location of Human Ortholog: 14q24.3

Cellular Component: nucleoplasm; spliceosome; transcription elongation factor complex b; nuclear matrix; chromatin; nucleus

Molecular Function: protein binding; vitamin D receptor binding; retinoic acid receptor binding; transcription coactivator activity; Notch binding; SMAD binding; transcription corepressor activity; nuclear hormone receptor binding

Biological Process: retinoic acid receptor signaling pathway; transcription initiation from RNA polymerase II promoter; Notch signaling pathway; positive regulation of neurogenesis; viral reproduction; positive regulation of transforming growth factor beta receptor signaling pathway; negative regulation of transcription from RNA polymerase II promoter; positive regulation of histone H3-K4 methylation; positive regulation of nuclear mRNA splicing, via spliceosome; nuclear mRNA splicing, via spliceosome; regulation of transcription from RNA polymerase II promoter; gene expression; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; DNA damage response, signal transduction by p53 class mediator resulting in induction of apoptosis; regulation of retinoic acid receptor signaling pathway

Research Articles on SNW1

Similar Products

Product Notes

The SNW1 snw1 (Catalog #AAA3220013) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SNW1 Antibody - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SNW1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SNW1 snw1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: SDRRQRGREG PVQFEEDPFG LDKFLEEAKQ HGGSKRPSDS SRPKEHEHEG. It is sometimes possible for the material contained within the vial of "SNW1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.