SLC44A4 blocking peptide
SLC44A4 Peptide - middle region
Gene Names
SLC44A4; CTL4; NG22; TPPT; DFNA72; hTPPT1; C6orf29
Reactivity
Human
Applications
Western Blot
Synonyms
SLC44A4; SLC44A4 Peptide - middle region; SLC44A4 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: MMSTMFYPLVTFVLLLICIAYWAMTALYLATSGQPQYVLWASNISSPGCE
Sequence Length
710
Applicable Applications for SLC44A4 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC44A4 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SLC44A4 Antibody, made
Target Description: The protein encoded by this gene may be a sodium-dependent transmembrane transport protein involved in the uptake of choline by cholinergic neurons. Defects in this gene can cause sialidosis, a lysosomal storage disease. Three transcript variants encoding different isoforms have been found for this gene.
Target Description: The protein encoded by this gene may be a sodium-dependent transmembrane transport protein involved in the uptake of choline by cholinergic neurons. Defects in this gene can cause sialidosis, a lysosomal storage disease. Three transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for SLC44A4 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
78kDa
NCBI Official Full Name
choline transporter-like protein 4 isoform 1
NCBI Official Synonym Full Names
solute carrier family 44 member 4
NCBI Official Symbol
SLC44A4
NCBI Official Synonym Symbols
CTL4; NG22; TPPT; DFNA72; hTPPT1; C6orf29
NCBI Protein Information
choline transporter-like protein 4
UniProt Protein Name
Choline transporter-like protein 4
Protein Family
UniProt Gene Name
SLC44A4
UniProt Synonym Gene Names
C6orf29; CTL4; NG22; UNQ441/PRO874
UniProt Entry Name
CTL4_HUMAN
NCBI Description
The protein encoded by this gene may be a sodium-dependent transmembrane transport protein involved in the uptake of choline by cholinergic neurons. Defects in this gene can cause sialidosis, a lysosomal storage disease. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2010]
Research Articles on SLC44A4
Similar Products
Product Notes
The SLC44A4 slc44a4 (Catalog #AAA3231468) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC44A4 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC44A4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC44A4 slc44a4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MMSTMFYPLV TFVLLLICIA YWAMTALYLA TSGQPQYVLW ASNISSPGCE. It is sometimes possible for the material contained within the vial of "SLC44A4, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
