Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SLC39A9 blocking peptide

SLC39A9 Peptide - middle region

Gene Names
SLC39A9; ZIP9; ZIP-9
Reactivity
Human
Applications
Western Blot
Synonyms
SLC39A9; SLC39A9 Peptide - middle region; SLC39A9 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
YIGVSLVLGFVFMLLVDQIGNSHVHSTDDPEAARSSNSKITTTLGLVVHA
Sequence Length
307
Applicable Applications for SLC39A9 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for SLC39A9 blocking peptide
This is a synthetic peptide designed for use in combination with anti-SLC39A9 Antibody, made

Target Description: SLC39A9 may act as a zinc-influx transporter.
Product Categories/Family for SLC39A9 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32kDa
NCBI Official Full Name
zinc transporter ZIP9 isoform 1
NCBI Official Synonym Full Names
solute carrier family 39 member 9
NCBI Official Symbol
SLC39A9
NCBI Official Synonym Symbols
ZIP9; ZIP-9
NCBI Protein Information
zinc transporter ZIP9
UniProt Protein Name
Zinc transporter ZIP9
Protein Family
UniProt Gene Name
SLC39A9
UniProt Synonym Gene Names
ZIP9; ZIP-9
UniProt Entry Name
S39A9_HUMAN

Uniprot Description

SLC39A9: May act as a zinc-influx transporter. Belongs to the ZIP transporter (TC 2.A.5) family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transporter; Membrane protein, integral; Membrane protein, multi-pass; Transporter, SLC family

Chromosomal Location of Human Ortholog: 14q24.1

Cellular Component: integral to membrane

Molecular Function: metal ion transmembrane transporter activity

Biological Process: zinc ion transport; transmembrane transport

Research Articles on SLC39A9

Similar Products

Product Notes

The SLC39A9 slc39a9 (Catalog #AAA3232109) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The SLC39A9 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SLC39A9 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SLC39A9 slc39a9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: YIGVSLVLGF VFMLLVDQIG NSHVHSTDDP EAARSSNSKI TTTLGLVVHA. It is sometimes possible for the material contained within the vial of "SLC39A9, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.