Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RBPJL blocking peptide

RBPJL Peptide - N-terminal region

Gene Names
RBPJL; RBPL; SUHL; RBPSUHL
Reactivity
Human
Applications
Western Blot
Synonyms
RBPJL; RBPJL Peptide - N-terminal region; RBPJL blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: DPAGAADPSVPPNPLTHLSLQDRSEMQLQSEADRRSLPGTWTRSSPEHTT
Sequence Length
516
Applicable Applications for RBPJL blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RBPJL blocking peptide
This is a synthetic peptide designed for use in combination with anti-RBPJL Antibody, made

Target Description: RBPJL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein. In mouse, recombining binding protein L (RBP-L) is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signalling pathway transcription factor RBP-J. However, unlike RBP-J, RBP-L does not interact with Notch receptors. RBP-L has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2 (EBNA2). RBPJL is similar in sequence to the mouse RPB-L protein and Drosophila suppressor of hairless protein.
Product Categories/Family for RBPJL blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
56kDa
NCBI Official Full Name
recombining binding protein suppressor of hairless-like protein isoform 2
NCBI Official Synonym Full Names
recombination signal binding protein for immunoglobulin kappa J region like
NCBI Official Symbol
RBPJL
NCBI Official Synonym Symbols
RBPL; SUHL; RBPSUHL
NCBI Protein Information
recombining binding protein suppressor of hairless-like protein
UniProt Protein Name
Recombining binding protein suppressor of hairless-like protein
UniProt Gene Name
RBPJL
UniProt Synonym Gene Names
RBPL; RBPSUHL
UniProt Entry Name
RBPJL_HUMAN

NCBI Description

This gene encodes a member of the suppressor of hairless protein family. A similar protein in mouse is a transcription factor that binds to DNA sequences almost identical to that bound by the Notch receptor signaling pathway transcription factor recombining binding protein J. The mouse protein has been shown to activate transcription in concert with Epstein-Barr virus nuclear antigen-2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2013]

Research Articles on RBPJL

Similar Products

Product Notes

The RBPJL rbpjl (Catalog #AAA3229391) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RBPJL Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RBPJL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RBPJL rbpjl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DPAGAADPSV PPNPLTHLSL QDRSEMQLQS EADRRSLPGT WTRSSPEHTT. It is sometimes possible for the material contained within the vial of "RBPJL, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.