Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-UCHL5IP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysateHAUS7 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Rabbit UCHL5IP Polyclonal Antibody | anti-HAUS7 antibody

UCHL5IP antibody - middle region

Gene Names
HAUS7; UIP1; UCHL5IP
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit
Applications
Western Blot
Purity
Affinity Purified
Synonyms
UCHL5IP; Polyclonal Antibody; UCHL5IP antibody - middle region; anti-HAUS7 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LLDTIRSLTIGCSSCSSLMEHFEDTREKNEALLGELFSSPHLQMLLNPEC
Sequence Length
427
Applicable Applications for anti-HAUS7 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 100%; Horse: 93%; Human: 100%; Mouse: 92%; Pig: 92%; Rabbit: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human UCHL5IP
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-UCHL5IP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysateHAUS7 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)

Western Blot (WB) (WB Suggested Anti-UCHL5IP Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: Hela cell lysateHAUS7 is strongly supported by BioGPS gene expression data to be expressed in Human HeLa cells)
Related Product Information for anti-HAUS7 antibody
This is a rabbit polyclonal antibody against UCHL5IP. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: This gene encodes a protein identified by interaction with ubiquitin C-terminal hydrolase 37, which functions to edit polyubiquitin chains on ubiquitinated substrates. This protein is a subunit of the multisubunit augmin complex, which regulates centrosom
Product Categories/Family for anti-HAUS7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
47kDa
NCBI Official Full Name
HAUS augmin-like complex subunit 7
NCBI Official Synonym Full Names
HAUS augmin like complex subunit 7
NCBI Official Symbol
HAUS7
NCBI Official Synonym Symbols
UIP1; UCHL5IP
NCBI Protein Information
HAUS augmin-like complex subunit 7
UniProt Protein Name
HAUS augmin-like complex subunit 7
Protein Family
UniProt Gene Name
HAUS7
UniProt Synonym Gene Names
UCHL5IP; UIP1
UniProt Entry Name
HAUS7_HUMAN

NCBI Description

This gene encodes a subunit of the augmin complex, which regulates centrosome and mitotic spindle integrity, and is necessary for the completion of cytokinesis. The encoded protein was identified by interaction with ubiquitin C-terminal hydrolase 37. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Sep 2012]

Uniprot Description

HAUS7: Contributes to mitotic spindle assembly, maintenance of centrosome integrity and completion of cytokinesis as part of the HAUS augmin-like complex. Belongs to the HAUS7 family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Deoxyribonuclease; EC 3.1.11.2

Chromosomal Location of Human Ortholog: Xq28

Cellular Component: microtubule; centrosome; cytoplasm; plasma membrane; nucleolus; spindle

Molecular Function: thioesterase binding

Biological Process: mitosis; cell division; centrosome organization and biogenesis; spindle assembly

Research Articles on HAUS7

Similar Products

Product Notes

The HAUS7 haus7 (Catalog #AAA3213104) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The UCHL5IP antibody - middle region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit and may cross-react with other species as described in the data sheet. AAA Biotech's UCHL5IP can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the HAUS7 haus7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LLDTIRSLTI GCSSCSSLME HFEDTREKNE ALLGELFSSP HLQMLLNPEC. It is sometimes possible for the material contained within the vial of "UCHL5IP, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.