Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

RAB14 blocking peptide

RAB14 Peptide - C-terminal region

Gene Names
RAB14; FBP; RAB-14
Reactivity
Human
Applications
Western Blot
Synonyms
RAB14; RAB14 Peptide - C-terminal region; RAB14 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: LIGNKADLEAQRDVTYEEAKQFAEENGLLFLEASAKTGENVEDAFLEAAK
Sequence Length
215
Applicable Applications for RAB14 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for RAB14 blocking peptide
This is a synthetic peptide designed for use in combination with anti-RAB14 Antibody, made

Target Description: RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes.
Product Categories/Family for RAB14 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
ras-related protein Rab-14
NCBI Official Synonym Full Names
RAB14, member RAS oncogene family
NCBI Official Symbol
RAB14
NCBI Official Synonym Symbols
FBP; RAB-14
NCBI Protein Information
ras-related protein Rab-14
UniProt Protein Name
Ras-related protein Rab-14
Protein Family
UniProt Gene Name
RAB14
UniProt Entry Name
RAB14_HUMAN

NCBI Description

RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]).[supplied by OMIM, Mar 2009]

Uniprot Description

RAB14: a protein of the GTPase superfamily, Rab family. May be involved in vesicular trafficking and neurotransmitter release. Localized to the inner face of the cell membrane by a lipid-anchor.

Protein type: G protein; G protein, monomeric; G protein, monomeric, Rab

Chromosomal Location of Human Ortholog: 9q33.2

Cellular Component: Golgi apparatus; Golgi stack; cytoplasmic vesicle membrane; nuclear envelope-endoplasmic reticulum network; intracellular membrane-bound organelle; rough endoplasmic reticulum; lysosomal membrane; lysosome; early endosome; phagocytic vesicle; cytosol; Golgi membrane; trans-Golgi network transport vesicle; recycling endosome; phagocytic vesicle membrane; perinuclear region of cytoplasm; early endosome membrane; late endosome; plasma membrane; intracellular

Molecular Function: GTPase activity; protein binding; GDP binding; GTP binding; myosin V binding

Biological Process: vesicle-mediated transport; intracellular protein transport; embryonic development; intracellular transport; fibroblast growth factor receptor signaling pathway; regulation of protein localization; metabolic process; Golgi to endosome transport; Rab protein signal transduction; endocytic recycling

Research Articles on RAB14

Similar Products

Product Notes

The RAB14 rab14 (Catalog #AAA3244041) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The RAB14 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's RAB14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RAB14 rab14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LIGNKADLEA QRDVTYEEAK QFAEENGLLF LEASAKTGEN VEDAFLEAAK. It is sometimes possible for the material contained within the vial of "RAB14, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.