Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Anti-RAB14 Picoband antibody, MBS178363, Western blottingAll lanes: Anti RAB14 (MBS178363) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: RAJI Whole Cell Lysate at 40ugLane 3: SMMC Whole Cell Lysate at 40ugPredicted bind size: 24KDObserved bind size: 24KD )

anti-Human, Rat RAB14 Polyclonal Antibody | anti-RAB14 antibody

Anti-RAB14 Antibody

Gene Names
RAB14; FBP; RAB-14
Reactivity
Human, Rat
Applications
Western Blot
Purity
Immunogen Affinity Purified
Synonyms
RAB14; Polyclonal Antibody; Anti-RAB14 Antibody; Ras-related protein Rab-14; bA165P4.3; F protein binding protein 1; FBP; GTPase Rab14; RAB 14; RAB14 member RAS oncogene family; RAB14_HUMAN; Ras related protein Rab 14; RP11 165P4.4; Small GTP binding protein RAB14; member RAS oncogene family; anti-RAB14 antibody
Ordering
For Research Use Only!
Reactivity
Human, Rat
Clonality
Polyclonal
Purity/Purification
Immunogen Affinity Purified
Form/Format
Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Sequence Length
215
Applicable Applications for anti-RAB14 antibody
Western Blot (WB)
Application Notes
Western Blot Concentration: 0.1-0.5ug/ml
Immunogen
A synthetic peptide corresponding to a sequence at the C-terminus of human RAB14 (124-153aa NKADLEAQRDVTYEEAKQFAEENGLLFLEA), identical to the related mouse and rat sequences.
Ig Type
Rabbit IgG
Reconstitution
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Preparation and Storage
At -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquoted and stored frozen at -20 degree C for a longer time. Avoid repeated freezing and thawing.

Western Blot (WB)

(Anti-RAB14 Picoband antibody, MBS178363, Western blottingAll lanes: Anti RAB14 (MBS178363) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: RAJI Whole Cell Lysate at 40ugLane 3: SMMC Whole Cell Lysate at 40ugPredicted bind size: 24KDObserved bind size: 24KD )

Western Blot (WB) (Anti-RAB14 Picoband antibody, MBS178363, Western blottingAll lanes: Anti RAB14 (MBS178363) at 0.5ug/mlLane 1: Rat Brain Tissue Lysate at 50ugLane 2: RAJI Whole Cell Lysate at 40ugLane 3: SMMC Whole Cell Lysate at 40ugPredicted bind size: 24KDObserved bind size: 24KD )
Related Product Information for anti-RAB14 antibody
Description: Rabbit IgG polyclonal antibody for Ras-related protein Rab-14(RAB14) detection. Tested with WB in Human;Rat.

Background: Ras-related protein Rab-14 is a protein that in humans is encoded by the RAB14 gene. It is mapped to 9q33.2 based on an alignment of the RAB14 sequence with the genomic sequence. RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes.
References
1. "Entrez Gene: RAB14 RAB14, member RAS oncogene family". 2. de Leeuw HP, Koster PM, Calafat J, Janssen H, van Zonneveld AJ, van Mourik JA, Voorberg J (Dec 1998). "Small GTP-binding proteins in human endothelial cells". Br J Haematol 103 (1): 15-9. 3. Junutula JR, De Maziere AM, Peden AA, Ervin KE, Advani RJ, van Dijk SM, Klumperman J, Scheller RH (Apr 2004). "Rab14 is involved in membrane trafficking between the Golgi complex and endosomes". Mol Biol Cell15 (5): 2218-29.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23,897 Da
NCBI Official Full Name
ras-related protein Rab-14
NCBI Official Synonym Full Names
RAB14, member RAS oncogene family
NCBI Official Symbol
RAB14
NCBI Official Synonym Symbols
FBP; RAB-14
NCBI Protein Information
ras-related protein Rab-14
UniProt Protein Name
Ras-related protein Rab-14
Protein Family
UniProt Gene Name
RAB14
UniProt Entry Name
RAB14_HUMAN

NCBI Description

RAB14 belongs to the large RAB family of low molecular mass GTPases that are involved in intracellular membrane trafficking. These proteins act as molecular switches that flip between an inactive GDP-bound state and an active GTP-bound state in which they recruit downstream effector proteins onto membranes (Junutula et al., 2004 [PubMed 15004230]).[supplied by OMIM, Mar 2009]

Uniprot Description

RAB14: a protein of the GTPase superfamily, Rab family. May be involved in vesicular trafficking and neurotransmitter release. Localized to the inner face of the cell membrane by a lipid-anchor.

Protein type: G protein; G protein, monomeric; G protein, monomeric, Rab

Chromosomal Location of Human Ortholog: 9q33.2

Cellular Component: apical plasma membrane; cytoplasmic vesicle membrane; cytosol; early endosome; early endosome membrane; Golgi apparatus; Golgi membrane; Golgi stack; intracellular; intracellular membrane-bound organelle; late endosome; lysosomal membrane; lysosome; nuclear envelope-endoplasmic reticulum network; perinuclear region of cytoplasm; phagocytic vesicle; plasma membrane; recycling endosome; rough endoplasmic reticulum; trans-Golgi network; trans-Golgi network transport vesicle

Molecular Function: GDP binding; glycoprotein binding; GTP binding; GTPase activity; myosin V binding; protein binding

Biological Process: apical protein localization; body fluid secretion; defense response to bacterium; embryonic development; endocytic recycling; fibroblast growth factor receptor signaling pathway; Golgi to endosome transport; intracellular protein transport; intracellular transport; metabolic process; nucleocytoplasmic transport; regulation of protein localization; small GTPase mediated signal transduction; vesicle-mediated transport

Research Articles on RAB14

Similar Products

Product Notes

The RAB14 rab14 (Catalog #AAA178363) is an Antibody and is intended for research purposes only. The product is available for immediate purchase. The Anti-RAB14 Antibody reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's RAB14 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Western Blot Concentration: 0.1-0.5ug/ml. Researchers should empirically determine the suitability of the RAB14 rab14 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "RAB14, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.