Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PRDM7 blocking peptide

PRDM7 Peptide - N-terminal region

Gene Names
PRDM7; PFM4; ZNF910
Reactivity
Human
Applications
Western Blot
Synonyms
PRDM7; PRDM7 Peptide - N-terminal region; PRDM7 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: FIDSCAAHGPPTFVKDSAVDKGHPNRSALSLPPGLRIGPSGIPQAGLGVW
Sequence Length
407
Applicable Applications for PRDM7 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PRDM7 blocking peptide
This is a synthetic peptide designed for use in combination with anti-PRDM7 Antibody, made

Target Description: The protein encoded by this gene is a transcription factor of the PR-domain protein family. It contains a PR-domain and multiple zinc finger motifs. Transcription factors of the PR-domain family are known to be involved in cell differentiation and tumorigenesis. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
Product Categories/Family for PRDM7 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44kDa
NCBI Official Full Name
probable histone-lysine N-methyltransferase PRDM7
NCBI Official Synonym Full Names
PR/SET domain 7
NCBI Official Symbol
PRDM7
NCBI Official Synonym Symbols
PFM4; ZNF910
NCBI Protein Information
probable histone-lysine N-methyltransferase PRDM7
UniProt Protein Name
Probable histone-lysine N-methyltransferase PRDM7
UniProt Gene Name
PRDM7
UniProt Synonym Gene Names
PFM4

NCBI Description

This gene encodes a member of a family of proteins that may have roles in transcription and other nuclear processes. The encoded protein contains a KRAB (Kruppel-associated box) domain -A box and a SET (Su(var)3-9, Enhancer-of-zeste, Trithorax) domain and may function as a histone methyltransferase. [provided by RefSeq, Aug 2013]

Uniprot Description

PRDM7: a probable histone methyltransferase. The mouse orthologous protein seems not to exist. Human PRDM7 and PRDM9 genes, a pair of close paralogs corresponding to a single mouse gene Prdm9, may have been generated by a recent gene duplication event after the divergence of the ancestors of human and mouse. Three isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.1.1.43; Methyltransferase; Methyltransferase, protein lysine

Chromosomal Location of Human Ortholog: 16q24.3

Cellular Component: chromosome; nucleus

Molecular Function: histone-lysine N-methyltransferase activity; nucleic acid binding; protein binding

Biological Process: regulation of transcription, DNA-templated

Research Articles on PRDM7

Similar Products

Product Notes

The PRDM7 prdm7 (Catalog #AAA3229572) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PRDM7 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PRDM7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PRDM7 prdm7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: FIDSCAAHGP PTFVKDSAVD KGHPNRSALS LPPGLRIGPS GIPQAGLGVW. It is sometimes possible for the material contained within the vial of "PRDM7, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.