Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged CD74 is 1 ng/ml as a capture antibody.)

Mouse CD74 Monoclonal Antibody | anti-CD74 antibody

CD74 (CD74 Molecule, Major Histocompatibility Complex, Class II invariant Chain, DHLAG, HLADG, Ia-GAMMA) (Biotin)

Gene Names
CD74; II; p33; DHLAG; HLADG; Ia-GAMMA
Applications
ELISA
Purity
Purified
Synonyms
CD74; Monoclonal Antibody; CD74 (CD74 Molecule; Major Histocompatibility Complex; Class II invariant Chain; DHLAG; HLADG; Ia-GAMMA) (Biotin); CD74 Molecule; Ia-GAMMA; anti-CD74 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F8
Specificity
Recognizes CD74.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Sequence Length
160
Applicable Applications for anti-CD74 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
CD74 (AAH24272, 1aa-160aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MHRRRSRSCREDQKPVMDDQRDLISNNEQLPMLGRRPGAPESKCSRGALYTGFSILVTLLLAGQATTAYFLYQQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQSHWNWRTRLLGWV
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged CD74 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged CD74 is 1 ng/ml as a capture antibody.)
Related Product Information for anti-CD74 antibody
Mouse monoclonal antibody raised against a full-length recombinant CD74.
Product Categories/Family for anti-CD74 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
972
NCBI Official Full Name
CD74 molecule, major histocompatibility complex, class II invariant chain
NCBI Official Synonym Full Names
CD74 molecule
NCBI Official Symbol
CD74
NCBI Official Synonym Symbols
II; p33; DHLAG; HLADG; Ia-GAMMA
NCBI Protein Information
HLA class II histocompatibility antigen gamma chain

NCBI Description

The protein encoded by this gene associates with class II major histocompatibility complex (MHC) and is an important chaperone that regulates antigen presentation for immune response. It also serves as cell surface receptor for the cytokine macrophage migration inhibitory factor (MIF) which, when bound to the encoded protein, initiates survival pathways and cell proliferation. This protein also interacts with amyloid precursor protein (APP) and suppresses the production of amyloid beta (Abeta). Multiple alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Aug 2011]

Research Articles on CD74

Similar Products

Product Notes

The CD74 (Catalog #AAA6174455) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's CD74 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the CD74 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "CD74, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.