Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PPP1R14A blocking peptide

PPP1R14A Peptide - N-terminal region

Gene Names
PPP1R14A; CPI17; CPI-17; PPP1INL
Reactivity
Human
Applications
Western Blot
Synonyms
PPP1R14A; PPP1R14A Peptide - N-terminal region; PPP1R14A blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
GKRVLSKLQSPSRARGPGGSPGGLQKRHARVTVKYDRRELQRRLDVEKWI
Sequence Length
147
Applicable Applications for PPP1R14A blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PPP1R14A blocking peptide
This is a synthetic peptide designed for use in combination with anti-PPP1R14A Antibody, made

Target Description: The protein encoded by this gene belongs to the protein phosphatase 1 (PP1) inhibitor family. This protein is an inhibitor of smooth muscle myosin phosphatase, and has higher inhibitory activity when phosphorylated. Inhibition of myosin phosphatase leads to increased myosin phosphorylation and enhanced smooth muscle contraction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene.
Product Categories/Family for PPP1R14A blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
17kDa
NCBI Official Full Name
protein phosphatase 1 regulatory subunit 14A isoform 1
NCBI Official Synonym Full Names
protein phosphatase 1 regulatory inhibitor subunit 14A
NCBI Official Symbol
PPP1R14A
NCBI Official Synonym Symbols
CPI17; CPI-17; PPP1INL
NCBI Protein Information
protein phosphatase 1 regulatory subunit 14A
UniProt Protein Name
Protein phosphatase 1 regulatory subunit 14A
UniProt Gene Name
PPP1R14A
UniProt Synonym Gene Names
CPI17; PPP1INL; CPI-17
UniProt Entry Name
PP14A_HUMAN

NCBI Description

The protein encoded by this gene belongs to the protein phosphatase 1 (PP1) inhibitor family. This protein is an inhibitor of smooth muscle myosin phosphatase, and has higher inhibitory activity when phosphorylated. Inhibition of myosin phosphatase leads to increased myosin phosphorylation and enhanced smooth muscle contraction. Alternatively spliced transcript variants encoding different isoforms have been noted for this gene. [provided by RefSeq, Sep 2011]

Uniprot Description

PPP1R14A: a phosphorylation-dependent inhibitory subunit of protein phosphatase 1 (PP-1A). Phosphorylation by PKC regulates its binding to PP-1A. Acts co-operatively to inhibit myosin light chain phosphatase (MLCP) activity. Inhibition leads to increased myosin phosphorylation and enhances smooth muscle contraction in the absence of increased intracellular Ca(2 ) concentration. Involved in the regulation of cell morphology, re-organisation of microfilaments, and cell spreading. Also expressed in human platelets and in brain where it may play a role in cerebellar long-term synaptic depression. Phosphorylation by ILK or Rho kinase enhances its ability to inhibit PP-1A.

Protein type: Protein phosphatase, regulatory subunit; Inhibitor

Chromosomal Location of Human Ortholog: 19q13.1

Cellular Component: cytoplasm

Molecular Function: protein phosphatase inhibitor activity

Biological Process: regulation of phosphorylation; negative regulation of catalytic activity

Research Articles on PPP1R14A

Similar Products

Product Notes

The PPP1R14A ppp1r14a (Catalog #AAA3241133) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PPP1R14A Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPP1R14A can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPP1R14A ppp1r14a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: GKRVLSKLQS PSRARGPGGS PGGLQKRHAR VTVKYDRREL QRRLDVEKWI. It is sometimes possible for the material contained within the vial of "PPP1R14A, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.