PPEF2 blocking peptide
PPEF2 Peptide - C-terminal region
Gene Names
PPEF2; PPP7CB
Reactivity
Human
Applications
Western Blot
Synonyms
PPEF2; PPEF2 Peptide - C-terminal region; PPEF2 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
LVTGEKEEPSRSASEADSEAGELRKPTQEEWRQVVDILWSDPMAQEGCKA
Sequence Length
753
Applicable Applications for PPEF2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PPEF2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-PPEF2 Antibody, made
Target Description: This gene encodes a member of the serine/threonine protein phosphatase with EF-hand motif family. The protein contains a protein phosphatase catalytic domain, and at least two EF-hand calcium-binding motifs in its C terminus. Although its substrate(s) is unknown, the encoded protein, which is expressed specifically in photoreceptors and the pineal, has been suggested to play a role in the visual system. This gene shares high sequence similarity with the Drosophila retinal degeneration C (rdgC) gene.
Target Description: This gene encodes a member of the serine/threonine protein phosphatase with EF-hand motif family. The protein contains a protein phosphatase catalytic domain, and at least two EF-hand calcium-binding motifs in its C terminus. Although its substrate(s) is unknown, the encoded protein, which is expressed specifically in photoreceptors and the pineal, has been suggested to play a role in the visual system. This gene shares high sequence similarity with the Drosophila retinal degeneration C (rdgC) gene.
Product Categories/Family for PPEF2 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
83kDa
NCBI Official Full Name
serine/threonine-protein phosphatase with EF-hands 2
NCBI Official Synonym Full Names
protein phosphatase with EF-hand domain 2
NCBI Official Symbol
PPEF2
NCBI Official Synonym Symbols
PPP7CB
NCBI Protein Information
serine/threonine-protein phosphatase with EF-hands 2
UniProt Protein Name
Serine/threonine-protein phosphatase with EF-hands 2
Protein Family
UniProt Gene Name
PPEF2
UniProt Synonym Gene Names
PPEF-2
UniProt Entry Name
PPE2_HUMAN
NCBI Description
This gene encodes a member of the serine/threonine protein phosphatase with EF-hand motif family. The protein contains a protein phosphatase catalytic domain, and at least two EF-hand calcium-binding motifs in its C terminus. Although its substrate(s) is unknown, the encoded protein, which is expressed specifically in photoreceptors and the pineal, has been suggested to play a role in the visual system. This gene shares high sequence similarity with the Drosophila retinal degeneration C (rdgC) gene. [provided by RefSeq, Jul 2008]
Research Articles on PPEF2
Similar Products
Product Notes
The PPEF2 ppef2 (Catalog #AAA3242297) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PPEF2 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's PPEF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the PPEF2 ppef2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: LVTGEKEEPS RSASEADSEA GELRKPTQEE WRQVVDILWS DPMAQEGCKA. It is sometimes possible for the material contained within the vial of "PPEF2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
