Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

PELI2 blocking peptide

PELI2 Peptide - N-terminal region

Reactivity
Human
Synonyms
PELI2; PELI2 Peptide - N-terminal region; PELI2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: KEPVKYGELVVLGYNGALPNGDRGRRKSRFALYKRPKANGVKPSTVHVIS
Sequence Length
420
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PELI2 blocking peptide
This is a synthetic peptide designed for use in combination with anti- PELI2 Antibody, made

Target Description: E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates IL1B-induced IRAK1 'Lys-63'-linked polyubiquitination and possibly 'Lys-48'-linked ubiquitination. May be important for LPS- and IL1B-induced MAP3K7-dependent, but not MAP3K3-dependent, NF-kappa-B activation. Can activate the MAP (mitogen activated protein) kinase pathway leading to activation of ELK1.
Product Categories/Family for PELI2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
46 kDa
NCBI Official Full Name
E3 ubiquitin-protein ligase pellino homolog 2
NCBI Official Synonym Full Names
pellino E3 ubiquitin protein ligase family member 2
NCBI Official Symbol
PELI2
NCBI Protein Information
E3 ubiquitin-protein ligase pellino homolog 2
UniProt Protein Name
E3 ubiquitin-protein ligase pellino homolog 2
UniProt Gene Name
PELI2
UniProt Synonym Gene Names
Pellino-2
UniProt Entry Name
PELI2_HUMAN

Uniprot Description

PELI2: E3 ubiquitin ligase catalyzing the covalent attachment of ubiquitin moieties onto substrate proteins. Involved in the TLR and IL-1 signaling pathways via interaction with the complex containing IRAK kinases and TRAF6. Mediates 'Lys-63'-linked polyubiquitination of IRAK1. Can activate the MAP (mitogen activated protein) kinase pathway leading to activation of ELK1. Not required for NF-kappa-B activation. Belongs to the pellino family.

Protein type: Adaptor/scaffold; EC 6.3.2.-; EC 6.3.2.19; Ubiquitin conjugating system; Ubiquitin ligase

Chromosomal Location of Human Ortholog: 14q21

Cellular Component: cytosol

Molecular Function: protein binding

Biological Process: positive regulation of I-kappaB kinase/NF-kappaB cascade; positive regulation of MAPKKK cascade; positive regulation of protein amino acid phosphorylation

Research Articles on PELI2

Similar Products

Product Notes

The PELI2 peli2 (Catalog #AAA3247524) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PELI2 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEPVKYGELV VLGYNGALPN GDRGRRKSRF ALYKRPKANG VKPSTVHVIS. It is sometimes possible for the material contained within the vial of "PELI2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.