PAXBP1 blocking peptide
PAXBP1 Peptide - middle region
Gene Names
PAXBP1; GCFC; BM020; GCFC1; FSAP105; C21orf66
Reactivity
Human
Synonyms
PAXBP1; PAXBP1 Peptide - middle region; PAXBP1 blocking peptide
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: KRQMARELGDFTPHDNEPGKGRLVREDENDASDDEDDDEKRRIVFSVKEK
Sequence Length
815
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for PAXBP1 blocking peptide
This gene encodes a protein that may bind to GC-rich DNA sequences, which suggests its involvement in the regulation of transcription. Alternative splicing of this gene results in multiple transcript variants.
Product Categories/Family for PAXBP1 blocking peptide
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93 kDa
NCBI Official Full Name
PAX3- and PAX7-binding protein 1 isoform 2
NCBI Official Synonym Full Names
PAX3 and PAX7 binding protein 1
NCBI Official Symbol
PAXBP1
NCBI Official Synonym Symbols
GCFC; BM020; GCFC1; FSAP105; C21orf66
NCBI Protein Information
PAX3- and PAX7-binding protein 1
UniProt Protein Name
PAX3- and PAX7-binding protein 1
Protein Family
UniProt Gene Name
PAXBP1
UniProt Synonym Gene Names
C21orf66; GCFC; GCFC1
UniProt Entry Name
PAXB1_HUMAN
NCBI Description
This gene encodes a protein that may bind to GC-rich DNA sequences, which suggests its involvement in the regulation of transcription. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jun 2009]
Research Articles on PAXBP1
Similar Products
Product Notes
The PAXBP1 paxbp1 (Catalog #AAA3246885) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The PAXBP1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: KRQMARELGD FTPHDNEPGK GRLVREDEND ASDDEDDDEK RRIVFSVKEK. It is sometimes possible for the material contained within the vial of "PAXBP1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
