Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

OTUB2 blocking peptide

OTUB2 Peptide - middle region

Gene Names
OTUB2; OTB2; OTU2; C14orf137
Reactivity
Human
Applications
Western Blot
Synonyms
OTUB2; OTUB2 Peptide - middle region; OTUB2 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
EEHKFRNFFNAFYSVVELVEKDGSVSSLLKVFNDQSASDHIVQFLRLLTS
Sequence Length
234
Applicable Applications for OTUB2 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for OTUB2 blocking peptide
This is a synthetic peptide designed for use in combination with anti-OTUB2 Antibody, made

Target Description: Otubains are deubiquitylating cysteine proteases (DUBs; see MIM 602519) that belong to the ovarian tumor (OTU) protein superfamily. Like other DUBs, otubains cleave proteins precisely at the ubiquitin (UB; see MIM 191339)-protein bond.
Product Categories/Family for OTUB2 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
27kDa
NCBI Official Full Name
ubiquitin thioesterase OTUB2
NCBI Official Synonym Full Names
OTU deubiquitinase, ubiquitin aldehyde binding 2
NCBI Official Symbol
OTUB2
NCBI Official Synonym Symbols
OTB2; OTU2; C14orf137
NCBI Protein Information
ubiquitin thioesterase OTUB2
UniProt Protein Name
Ubiquitin thioesterase OTUB2
Protein Family
UniProt Gene Name
OTUB2
UniProt Synonym Gene Names
C14orf137; OTB2; OTU2
UniProt Entry Name
OTUB2_HUMAN

NCBI Description

This gene encodes one of several deubiquitylating enzymes. Ubiquitin modification of proteins is needed for their stability and function; to reverse the process, deubiquityling enzymes remove ubiquitin. This protein contains an OTU domain and binds Ubal (ubiquitin aldehyde); an active cysteine protease site is present in the OTU domain. [provided by RefSeq, Aug 2011]

Uniprot Description

OTUB2: Hydrolase that can remove conjugated ubiquitin from proteins in vitro and may therefore play an important regulatory role at the level of protein turnover by preventing degradation. Mediates deubiquitination of both 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains, with a preference for 'Lys-63'-linked polyubiquitin chains. Belongs to the peptidase C65 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 3.4.19.12; Hydrolase; Ubiquitin-specific protease

Chromosomal Location of Human Ortholog: 14q32.12

Cellular Component: nucleus

Molecular Function: ubiquitin-specific protease activity

Biological Process: protein deubiquitination; proteolysis

Research Articles on OTUB2

Similar Products

Product Notes

The OTUB2 otub2 (Catalog #AAA3239203) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The OTUB2 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's OTUB2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OTUB2 otub2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: EEHKFRNFFN AFYSVVELVE KDGSVSSLLK VFNDQSASDH IVQFLRLLTS. It is sometimes possible for the material contained within the vial of "OTUB2, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.