Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NUS1 blocking peptide

NUS1 Peptide - middle region

Gene Names
NUS1; NgBR; MRD55; CDG1AA; C6orf68; TANGO14; MGC:7199
Reactivity
Human
Synonyms
NUS1; NUS1 Peptide - middle region; NUS1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: SRLMDEILKQQQELLGLDCSKYSPEFANSNDKDDQVLNCHLAVKVLSPED
Sequence Length
293
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NUS1 blocking peptide
This is a synthetic peptide designed for use in combination with anti- NUS1 Antibody, made

Target Description: With DHDDS, forms the dehydrodolichyl diphosphate synthase (DDS) complex, an essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Adds multiple copies of isopentenyl pyrophosphate (IPP) to farnesyl pyrophosphate (FPP) to produce dehydrodolichyl diphosphate (Dedol-PP), a precusrosor of dolichol which is utilized as a sugar carrier in protein glycosylation in the endoplasmic reticulum (ER). Regulates the glycosylation and stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator.
Product Categories/Family for NUS1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
dehydrodolichyl diphosphate synthase complex subunit NUS1
NCBI Official Synonym Full Names
NUS1 dehydrodolichyl diphosphate synthase subunit
NCBI Official Symbol
NUS1
NCBI Official Synonym Symbols
NgBR; MRD55; CDG1AA; C6orf68; TANGO14; MGC:7199
NCBI Protein Information
dehydrodolichyl diphosphate synthase complex subunit NUS1
UniProt Protein Name
Nogo-B receptor
UniProt Gene Name
NUS1
UniProt Synonym Gene Names
C6orf68; NGBR; NgBR
UniProt Entry Name
NGBR_HUMAN

NCBI Description

This gene encodes a type I single transmembrane domain receptor, which is a subunit of cis-prenyltransferase, and serves as a specific receptor for the neural and cardiovascular regulator Nogo-B. The encoded protein is essential for dolichol synthesis and protein glycosylation. This gene is highly expressed in non-small cell lung carcinomas as well as estrogen receptor-alpha positive breast cancer cells where it promotes epithelial mesenchymal transition. This gene is associated with the poor prognosis of human hepatocellular carcinoma patients. Naturally occurring mutations in this gene cause a congenital disorder of glycosylation and are associated with epilepsy. A knockout of the orthologous gene in mice causes embryonic lethality before day 6.5. Pseudogenes of this gene have been defined on chromosomes 13 and X. [provided by RefSeq, May 2017]

Uniprot Description

Function: Acts as a specific receptor for the N-terminus of Nogo-B, a neural and cardiovascular regulator. Regulates the stability of nascent NPC2, thereby promoting trafficking of LDL-derived cholesterol. Ref.5 Ref.7Essential component of the dolichol monophosphate (Dol-P) biosynthetic machinery. Ref.5 Ref.7

Pathway: Protein modification; protein glycosylation.

Subunit structure: Interacts with DHDDS, promoting its isoprenyltransferase activity. Interacts with NPC2. Ref.6 Ref.7

Subcellular location: Endoplasmic reticulum membrane; Single-pass type I membrane protein. Note: Colocalizes with Nogo-B during VEGF and wound healing angiogenesis. Ref.6 Ref.7

Miscellaneous: Although strongly related to UPP synthase family proteins, it has no lipid transferase activity.NUS1 seems to exist in two topological orientations, a minor glycosylated species with its C-terminus oriented towards the lumen regulating NPC2 stability, and a major fraction oriented with its C-terminus directed towards the cytosol where it regulates cis-IPTase activity.

Sequence similarities: Belongs to the UPP synthase family.

Sequence caution: The sequence AAB72234.1 differs from that shown. Reason: Frameshift at several positions.

Research Articles on NUS1

Similar Products

Product Notes

The NUS1 nus1 (Catalog #AAA3246720) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NUS1 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. The amino acid sequence is listed below: Synthetic peptide located within the following region: SRLMDEILKQ QQELLGLDCS KYSPEFANSN DKDDQVLNCH LAVKVLSPED. It is sometimes possible for the material contained within the vial of "NUS1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.