Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NUP153 blocking peptide

NUP153 Peptide - C-terminal region

Gene Names
NUP153; N153; HNUP153
Reactivity
Human
Applications
Western Blot
Synonyms
NUP153; NUP153 Peptide - C-terminal region; NUP153 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
PKCQPVFSFGNSEQTKDENSSKSTFSFSMTKPSEKESEQPAKATFAFGAQ
Sequence Length
1475
Applicable Applications for NUP153 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NUP153 blocking peptide
This is a synthetic peptide designed for use in combination with anti-NUP153 Antibody, made

Target Description: Nuclear pore complexes are extremely elaborate structures that mediate the regulated movement of macromolecules between the nucleus and cytoplasm. These complexes are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. Nucleoporins are pore complex-specific glycoproteins characterized by cytoplasmically oriented O-linked N-acetylglucosamine residues and numerous repeats of the pentapeptide sequence XFXFG. The protein encoded by this gene has three distinct domains: a N-terminal region within which a pore targeting domain has been identified, a central region containing multiple zinc finger motifs, and a C-terminal region containing multiple XFXFG repeats.
Product Categories/Family for NUP153 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
162kDa
NCBI Official Full Name
nuclear pore complex protein Nup153 isoform 2
NCBI Official Synonym Full Names
nucleoporin 153
NCBI Official Symbol
NUP153
NCBI Official Synonym Symbols
N153; HNUP153
NCBI Protein Information
nuclear pore complex protein Nup153
UniProt Protein Name
Nuclear pore complex protein Nup153
UniProt Gene Name
NUP153
UniProt Entry Name
NU153_HUMAN

NCBI Description

Nuclear pore complexes regulate the transport of macromolecules between the nucleus and cytoplasm. They are composed of at least 100 different polypeptide subunits, many of which belong to the nucleoporin family. Nucleoporins are glycoproteins found in nuclear pores and contain characteristic pentapeptide XFXFG repeats as well as O-linked N-acetylglucosamine residues oriented towards the cytoplasm. The protein encoded by this gene has three distinct domains: a N-terminal region containing a pore targeting and an RNA-binding domain domain, a central region containing multiple zinc finger motifs, and a C-terminal region containing multiple XFXFG repeats. Alternative splicing results in multiple transcript variants of this gene. [provided by RefSeq, May 2013]

Uniprot Description

NUP153: Possible DNA-binding subunit of the nuclear pore complex (NPC). The repeat-containing domain may be involved in anchoring components of the pore complex to the pore membrane.

Protein type: Nucleoporin; Nuclear export

Chromosomal Location of Human Ortholog: 6p22.3

Cellular Component: nucleoplasm; nuclear membrane; cytoplasm; nucleolus; nuclear pore; nuclear inclusion body

Molecular Function: identical protein binding; protein binding; DNA binding; structural constituent of nuclear pore; zinc ion binding; transporter activity; protein anchor; nucleocytoplasmic transporter activity

Biological Process: nuclear pore complex assembly; entry of virus into host cell; mRNA transport; viral reproduction; cytokine and chemokine mediated signaling pathway; mitotic nuclear envelope disassembly; pathogenesis; glucose transport; viral infectious cycle; negative regulation of RNA export from nucleus; protein transport; hexose transport; carbohydrate metabolic process; gene expression; viral transcription; mitotic cell cycle; transmembrane transport

Research Articles on NUP153

Similar Products

Product Notes

The NUP153 nup153 (Catalog #AAA3240140) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NUP153 Peptide - C-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NUP153 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NUP153 nup153 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: PKCQPVFSFG NSEQTKDENS SKSTFSFSMT KPSEKESEQP AKATFAFGAQ. It is sometimes possible for the material contained within the vial of "NUP153, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.