Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NTHL1 blocking peptide

NTHL1 Peptide - N-terminal region

Gene Names
NTHL1; FAP3; NTH1; OCTS3; hNTH1
Reactivity
Human
Applications
Western Blot
Synonyms
NTHL1; NTHL1 Peptide - N-terminal region; NTHL1 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
DWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS
Sequence Length
312
Applicable Applications for NTHL1 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NTHL1 blocking peptide
This is a synthetic peptide designed for use in combination with anti-NTHL1 Antibody, made

Target Description: The protein encoded by this gene is a DNA N-glycosylase of the endonuclease III family. Like a similar protein in E. coli, the encoded protein has DNA glycosylase activity on DNA substrates containing oxidized pyrimidine residues and has apurinic/apyrimidinic lyase activity.
Product Categories/Family for NTHL1 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
34kDa
NCBI Official Full Name
endonuclease III-like protein 1 isoform 1
NCBI Official Synonym Full Names
nth like DNA glycosylase 1
NCBI Official Symbol
NTHL1
NCBI Official Synonym Symbols
FAP3; NTH1; OCTS3; hNTH1
NCBI Protein Information
endonuclease III-like protein 1
UniProt Protein Name
Endonuclease III-like protein 1
UniProt Gene Name
NTHL1
UniProt Synonym Gene Names
hNTH1
UniProt Entry Name
NTH_HUMAN

NCBI Description

The protein encoded by this gene is a DNA N-glycosylase of the endonuclease III family. Like a similar protein in E. coli, the encoded protein has DNA glycosylase activity on DNA substrates containing oxidized pyrimidine residues and has apurinic/apyrimidinic lyase activity. [provided by RefSeq, Oct 2008]

Uniprot Description

NTHL1: Has both an apurinic and/or apyrimidinic endonuclease activity and a DNA N-glycosylase activity. Incises damaged DNA at cytosines, thymines and guanines. Acts on a damaged strand, 5' from the damaged site. Required for the repair of both oxidative DNA damage and spontaneous mutagenic lesions. Belongs to the Nth/MutY family.

Protein type: DNA repair, damage; Hydrolase; Mitochondrial; EC 4.2.99.18; Lyase

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: nucleoplasm; mitochondrion; nucleus

Molecular Function: protein binding; DNA-(apurinic or apyrimidinic site) lyase activity; endonuclease activity; metal ion binding; 4 iron, 4 sulfur cluster binding; double-stranded DNA binding; DNA N-glycosylase activity

Biological Process: base-excision repair, AP site formation; base-excision repair; depyrimidination; DNA repair; nucleotide-excision repair, DNA incision, 5'-to lesion; DNA catabolic process, endonucleolytic

Disease: Familial Adenomatous Polyposis 3

Research Articles on NTHL1

Similar Products

Product Notes

The NTHL1 nthl1 (Catalog #AAA3241246) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NTHL1 Peptide - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NTHL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NTHL1 nthl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: DWQQQLVNIR AMRNKKDAPV DHLGTEHCYD SSAPPKVRRY QVLLSLMLSS. It is sometimes possible for the material contained within the vial of "NTHL1, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.