Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

NEIL3 blocking peptide

NEIL3 Peptide - middle region

Gene Names
NEIL3; FGP2; FPG2; NEI3; ZGRF3; hFPG2; hNEI3
Reactivity
Human
Applications
Western Blot
Synonyms
NEIL3; NEIL3 Peptide - middle region; NEIL3 blocking peptide
Ordering
For Research Use Only!
Reactivity
Human
Form/Format
Lyophilized powder
Sequence
Synthetic peptide located within the following region: VLTDFSNKSSTLERKTKQNQILDEEFQNSPPASVCLNDIQHPSKKTTNDI
Sequence Length
605
Applicable Applications for NEIL3 blocking peptide
Western Blot (WB)
Preparation and Storage
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -20 degree C. Avoid repeat freeze-thaw cycles.
Related Product Information for NEIL3 blocking peptide
This is a synthetic peptide designed for use in combination with anti-NEIL3 Antibody, made

Target Description: NEIL3 belongs to a class of DNA glycosylases homologous to the bacterial Fpg/Nei family. These glycosylases initiate the first step in base excision repair by cleaving bases damaged by reactive oxygen species and introducing a DNA strand break via the associated lyase reaction (Bandaru et al., 2002 [PubMed 12509226]).[supplied by OMIM, Mar 2008]
Product Categories/Family for NEIL3 blocking peptide

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
67 kDa
NCBI Official Full Name
endonuclease 8-like 3
NCBI Official Synonym Full Names
nei like DNA glycosylase 3
NCBI Official Symbol
NEIL3
NCBI Official Synonym Symbols
FGP2; FPG2; NEI3; ZGRF3; hFPG2; hNEI3
NCBI Protein Information
endonuclease 8-like 3
UniProt Protein Name
Endonuclease 8-like 3
Protein Family
UniProt Gene Name
NEIL3
UniProt Entry Name
NEIL3_HUMAN

NCBI Description

NEIL3 belongs to a class of DNA glycosylases homologous to the bacterial Fpg/Nei family. These glycosylases initiate the first step in base excision repair by cleaving bases damaged by reactive oxygen species and introducing a DNA strand break via the associated lyase reaction (Bandaru et al., 2002 [PubMed 12509226]).[supplied by OMIM, Mar 2008]

Uniprot Description

NEIL3: Reports about DNA glycosylase activity are contradictory. A number of references report finding no DNA glycosylase activity and the protein lacks a proline residue at the N-terminus which functions as an active site residue in other members of the FPG family. However, the mouse ortholog has been shown to have both DNA glycosylase and AP lyase activities and PubMed:19170771 demonstrates AP lyase activity. Prefers single- stranded DNA or partially single-stranded DNA structures such as bubble and fork structures to double-stranded DNA in vitro. Displays a broad recognition spectrum, preferring FapyA and FapyG followed by 5-OHU, 5-PHC and 5-OHMH and then Tg and 8-oxoA. No activity on 8-oxoG detected. Belongs to the FPG family.

Protein type: EC 4.2.99.18; DNA-binding

Chromosomal Location of Human Ortholog: 4q34.3

Cellular Component: nucleus

Molecular Function: DNA-(apurinic or apyrimidinic site) lyase activity; zinc ion binding; double-stranded DNA binding; DNA N-glycosylase activity; damaged DNA binding; bubble DNA binding; single-stranded DNA binding

Biological Process: nucleotide-excision repair; base-excision repair; DNA catabolic process, endonucleolytic

Research Articles on NEIL3

Similar Products

Product Notes

The NEIL3 neil3 (Catalog #AAA3244906) is a Blocking Peptide and is intended for research purposes only. The product is available for immediate purchase. The NEIL3 Peptide - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NEIL3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NEIL3 neil3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VLTDFSNKSS TLERKTKQNQ ILDEEFQNSP PASVCLNDIQ HPSKKTTNDI. It is sometimes possible for the material contained within the vial of "NEIL3, Blocking Peptide" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.